Entry information : PgigMnP05 (MnP-long)
Entry ID 9661
Creation 2011-11-09 (Christophe Dunand)
Last sequence changes 2012-03-28 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: PgigMnP05 (MnP-long)
Name (synonym) PgigMnP05 (MnP-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP05
start..stop
S start..stop
PcMnP05 645 0 1..381 1..381
PcMnP02_OGC101 640 0 1..381 1..382
PcMnP02_RP78 638 0 1..381 1..382
PcMnP03_RP78 635 0 18..381 19..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 124421..124601 181 N° 2 124659..124685 27 N° 3 124736..124775 40 N° 4 124834..125011 178
N° 5 125068..125289 222 N° 6 125347..125761 415 N° 7 125818..125900 83  
join(124421..124601,124659..124685,124736..124775,124834..125011,125068..125289, 125347..125761,125818..125900)


exon

Literature and cross-references PgigMnP05 (MnP-long)
DNA ref. JGI genome:   scaffold_19 (124421..125900)
Cluster/Prediction ref. JGI gene:   65970 [Incorrect prediction]
Protein sequence: PgigMnP05 (MnP-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (363)
PWM (Da):   %s   39521 (37724.0)  
PI (pH):   %s   3.92 (3.88) Peptide Signal:   %s   cut: 19 range:19-381
Sequence 422
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYGHLLALATLSTVALAAPAADSTTCPDGTTVSNAACCAFIPLAQDLQNTLFMNDCGEDAHEVIRLTFHDAIAISQSKGPSAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFMQTHDTISAGDLIQFAGAVALSNCPGAPQLEFLAGRPNQTIAAIDGLIPEPQDSVDTILDRFADAGNFSPFEVISLLASHSVARADKVDTSIDAAPFDTTPFTFDTQIFLEVLLKGVGFPGSPNNTGEVESPLPLGSGSDTGEMRLQSDFALARDSRTACFWQGFVNEQEFMASSFKAAMSKMAILGHSRSDLIDCSDVVPAPKSAVNAPASFPATTGPDDLELTCTSSQFPSLTIDVGATETLIPHCSNGGQDCPSVQFSGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Incorrect prediction from JGI (fusion of two tandem duplicated genes).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTACGGTCACCTCCTAGCACTGGCTACTCTCAGCACCGTCGCCCTCGCTGCTCCGGCCGCTGACAGCACTACGTGCCCTGACGGCACGACGGTCAGCAACGCTGCCTGCTGCGCCT
TTATCCCCCTCGCCCAGGACTTGCAGAACACGCTTTTCATGAATGACTGTGGCGAGGATG
GTTTGTAGCTCCCGCTATGTGTCTGATTACCATACGCTAACTATCTTTCGATTACAGCGC
ACGAGGTCATCCGACTGACATTTC
GTAAGTAACAAGGAAGTTACACGTGATGGGTGACGTTGACTTGTATGCAGACGATGCCATCGCTATCTCGCAGAGCAAAGGTCCTTCCGCGTTCGT
AGTCATCAATTATGGTCGGGTAGATCTCCTGGTTACTGACATTTTGCCACAGTGGCGGAGGAGCTGACGGTTCTATGCTCCTCTTCCCTACTGTCGAGCCAAATTTTTCAGCCAACAACG
GCATCGACGACTCCGTCAATAATCTGATCCCCTTCATGCAGACCCATGACACGATCAGTGCTGGTGACCTCATCCAGTTCGCGGGTGCCGTCGCTCTTAGCAACTGCCCC
GTACGTTCCA
TAGCCTTCCAACACTGCATGAATCTTGACATCTACTGCGCCATCAGGGAGCGCCTCAACTCGAATTCTTGGCCGGCCGGCCCAACCAAACCATCGCGGCCATCGACGGCTTGATCCCAGA
ACCACAGGACTCCGTTGACACTATCTTGGACCGCTTTGCAGATGCGGGGAACTTCAGTCCATTCGAAGTTATCTCCCTCCTCGCATCCCACAGTGTCGCGCGCGCCGACAAAGTTGATAC
GTCCATTGACGCGGCTCCCTTTGACACC
GTAAGCTAACAACTCCAGACGTCGGTACACGATCCGTACTAAGTAATCTATGCCCAGACTCCTTTCACCTTCGATACCCAGATCTTCCTCGA
AGTACTTCTGAAGGGTGTCGGCTTCCCTGGAAGCCCTAACAACACCGGCGAAGTCGAGTCTCCTCTTCCGCTGGGAAGCGGCAGCGACACTGGCGAGATGCGTCTACAGTCCGACTTTGC
GCTCGCGCGCGACTCGCGCACGGCGTGCTTCTGGCAGGGCTTCGTCAACGAACAGGAGTTCATGGCAAGCAGCTTCAAGGCCGCGATGTCAAAGATGGCCATCCTGGGCCACAGCCGCAG
TGATTTGATCGACTGCTCCGACGTTGTCCCCGCGCCCAAGTCTGCGGTCAACGCCCCTGCGTCTTTCCCCGCGACCACCGGCCCTGATGACCTCGAGCTCACATGCACTTCGTCGCAATT
CCCGTCTCTTACTATCGATG
GTGGGTACCCCCCGATCTGTCTATAGTGTAGCCGCAGCTGACACTTATACTCACAGTCGGGGCAACGGAGACTCTCATTCCCCACTGCTCAAACGGTGGC
CAGGACTGTCCCTCCGTACAGTTCTCTGGCCCGGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTACGGTCACCTCCTAGCACTGGCTACTCTCAGCACCGTCGCCCTCGCTGCTCCGGCCGCTGACAGCACTACGTGCCCTGACGGCACGACGGTCAGCAACGCTGCCTGCTGCGCCT
TTATCCCCCTCGCCCAGGACTTGCAGAACACGCTTTTCATGAATGACTGTGGCGAGGATG
CGCACGAGGTCATCCGACTGACATTTCACGATGCCATCGCTATCTCGCAGAGCAAAGGTC
CTTCCGC
TGGCGGAGGAGCTGACGGTTCTATGCTCCTCTTCCCTACTGTCGAGCCAAATTTTTCAGCCAACAACGGCATCGACGACTCCGTCAATAATCTGATCCCCTTCATGCAGACCC
ATGACACGATCAGTGCTGGTGACCTCATCCAGTTCGCGGGTGCCGTCGCTCTTAGCAACTGCCCC
GGAGCGCCTCAACTCGAATTCTTGGCCGGCCGGCCCAACCAAACCATCGCGGCCA
TCGACGGCTTGATCCCAGAACCACAGGACTCCGTTGACACTATCTTGGACCGCTTTGCAGATGCGGGGAACTTCAGTCCATTCGAAGTTATCTCCCTCCTCGCATCCCACAGTGTCGCGC
GCGCCGACAAAGTTGATACGTCCATTGACGCGGCTCCCTTTGACACC
ACTCCTTTCACCTTCGATACCCAGATCTTCCTCGAAGTACTTCTGAAGGGTGTCGGCTTCCCTGGAAGCCCTA
ACAACACCGGCGAAGTCGAGTCTCCTCTTCCGCTGGGAAGCGGCAGCGACACTGGCGAGATGCGTCTACAGTCCGACTTTGCGCTCGCGCGCGACTCGCGCACGGCGTGCTTCTGGCAGG
GCTTCGTCAACGAACAGGAGTTCATGGCAAGCAGCTTCAAGGCCGCGATGTCAAAGATGGCCATCCTGGGCCACAGCCGCAGTGATTTGATCGACTGCTCCGACGTTGTCCCCGCGCCCA
AGTCTGCGGTCAACGCCCCTGCGTCTTTCCCCGCGACCACCGGCCCTGATGACCTCGAGCTCACATGCACTTCGTCGCAATTCCCGTCTCTTACTATCGATG
TCGGGGCAACGGAGACTC
TCATTCCCCACTGCTCAAACGGTGGCCAGGACTGTCCCTCCGTACAGTTCTCTGGCCCGGCCTAA

Retrieve as FASTA