Entry information : PgigMnP06 ( PutativeMnP)
Entry ID 9663
Creation 2011-11-09 (Christophe Dunand)
Last sequence changes 2013-09-16 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-11 (Catherine Mathe)
Peroxidase information: PgigMnP06 ( PutativeMnP)
Name (synonym) PgigMnP06 ( PutativeMnP)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP06
start..stop
S start..stop
CsuMnP05 563 0 1..353 1..377
PsoMnP02 562 0 1..353 1..377
PbreMnP04 557 0 1..356 1..383
PbreMnP03 556 0 1..357 1..384
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 134076..134201 126 N° 2 134257..134308 52 N° 3 134365..134391 27 N° 4 134444..134483 40
N° 5 134541..134715 175 N° 6 134771..134914 144 N° 7 134973..135387 415 N° 8 135449..135543 95
join(134076..134201,134257..134308,134365..134391,134444..134483,134541..134715, 134771..134914,134973..135387,135449..135543)


exon

Literature and cross-references PgigMnP06 ( PutativeMnP)
DNA ref. GenBank:   AZAG01000188.1 (67743..69207) JGI genome:   scaffold_19 (134076..135543)
Cluster/Prediction ref. JGI gene:   65951 [Incorrect prediction]
Protein sequence: PgigMnP06 ( PutativeMnP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (339)
PWM (Da):   %s   36975.23 (35212.3)  
PI (pH):   %s   4.26 (4.26) Peptide Signal:   %s   cut: 19 range:19-357
Sequence 398
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFVSLFALAALATVVSAAPSKTAVCADGTRVSNDACCAFIPLAQDLQDNLFQGDCGEDAHEVVRLTFHDAIAISRSQGPKAGGGADGSMLLFPTVEPLFPPNNGISDSVNNLLHFLPLHPVSAGDLIQFAGAVALSNCPGAPQLEFLAGRPNKTFAAVQGLIPEPSDSVTKILDKVDETIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGTANNTGEVASPLPLGSGTDTGEMRLQSDFVLARDSRTACFWQGFVNEQEFMAASFKAAMAKLAVLGHNRNALIDCSDVVPTPKPAVGTPASFPATTGPQDLELSCNTARFPKLAVQAGTEQAIIPHCSTGGMSCPGVDFDGPAQDSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). Region around the proximal H is missing. Incorrect prediction from JGI (two last exon: prediction with last exon in the last intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCGTATCTCTTTTCGCATTGGCTGCTCTCGCCACGGTCGTCAGCGCCGCCCCCAGTAAAACCGCTGTCTGCGCCGACGGCACCAGAGTGTCCAACGACGCTTGCTGTGCCTTCA
TCCCT
GTAAGTGCCAGCTGGCCATAACAATTTGGCCACCATTTAATTCACTGCTCGACAGCTCGCCCAGGATCTCCAGGACAATCTGTTCCAGGGGGACTGTGGTGAAGATGGTATGGCA
TTTCCTACCGGTTCTAGAAGAGAATACTTACTGATACGATATTCACAGCCCACGAAGTCGTCCGCTTGACTTTCCGTACGAACAGCTTACCCTGACTTAGATCACTGCTTACTAACACCC
AATCTAGACGATGCCATTGCGATTTCTCGTAGCCAGGGACCCAAGGCGTGCGTCTCCCTCCCCCTCGGCACTTGAAGCCTATATCTAACAACGCTCCTCTACAGTGGTGGAGGAGCCGAC
GGCTCCATGCTCCTTTTCCCGACTGTTGAGCCTCTCTTCCCGCCCAACAATGGTATCTCCGACAGCGTCAACAACCTCCTTCATTTCCTACCCCTCCACCCGGTCAGTGCTGGTGACCTG
ATTCAGTTCGCTGGTGCCGTTGCCCTCTCCAACTGCCCT
GTAAGCCACATGTTCTACTCTTGCATTCGTGACTCTGACAACAGACATACCATAGGGTGCTCCTCAGCTCGAGTTCCTGGC
TGGTCGCCCGAACAAGACATTCGCTGCCGTCCAAGGTCTCATTCCCGAGCCTTCAGACAGCGTCACCAAGATTCTAGACAAGGTAGATGAGACCATAGACGCTGCTCCCTTCGACTCC
GT
AAGGACTATGCTCCCACTACTGCACAAACTGAGCGACTAACAATTTTCGGCCACAGACTCCGTTCACCTTCGACACCCAGGTCTTCCTCGAGGTCCTCCTGAAGGGTACCGGCTTCCCCG
GAACCGCCAACAACACCGGCGAAGTCGCGTCTCCCCTGCCCCTTGGTAGCGGTACCGACACCGGCGAGATGCGTCTCCAGTCCGACTTCGTGCTCGCCCGCGACTCGCGCACTGCGTGCT
TCTGGCAGGGCTTTGTCAACGAGCAGGAGTTCATGGCTGCGTCGTTCAAGGCCGCGATGGCAAAGCTCGCGGTGCTCGGCCACAACCGCAACGCGCTCATCGACTGCTCCGACGTCGTCC
CTACGCCCAAGCCCGCCGTCGGCACGCCAGCGTCGTTCCCCGCCACGACCGGCCCCCAGGACCTCGAGCTCTCGTGCAACACCGCTCGCTTCCCCAAGCTCGCCGTCCAGG
GTAAGCGCT
GCTGCTGGAATTGCGACCGTGTGCGTAAGATACTCATCATGTCTACTCACAGCCGGCACCGAGCAGGCTATCATTCCTCACTGCTCCACCGGTGGCATGTCTTGCCCCGGCGTCGACTTC
GACGGCCCCGCTCAGGATAGCTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCGTATCTCTTTTCGCATTGGCTGCTCTCGCCACGGTCGTCAGCGCCGCCCCCAGTAAAACCGCTGTCTGCGCCGACGGCACCAGAGTGTCCAACGACGCTTGCTGTGCCTTCA
TCCCT
CTCGCCCAGGATCTCCAGGACAATCTGTTCCAGGGGGACTGTGGTGAAGATGCCCACGAAGTCGTCCGCTTGACTTTCCACGATGCCATTGCGATTTCTCGTAGCCAGGGACCCA
AGGC
TGGTGGAGGAGCCGACGGCTCCATGCTCCTTTTCCCGACTGTTGAGCCTCTCTTCCCGCCCAACAATGGTATCTCCGACAGCGTCAACAACCTCCTTCATTTCCTACCCCTCCACC
CGGTCAGTGCTGGTGACCTGATTCAGTTCGCTGGTGCCGTTGCCCTCTCCAACTGCCCT
GGTGCTCCTCAGCTCGAGTTCCTGGCTGGTCGCCCGAACAAGACATTCGCTGCCGTCCAAG
GTCTCATTCCCGAGCCTTCAGACAGCGTCACCAAGATTCTAGACAAGGTAGATGAGACCATAGACGCTGCTCCCTTCGACTCC
ACTCCGTTCACCTTCGACACCCAGGTCTTCCTCGAGG
TCCTCCTGAAGGGTACCGGCTTCCCCGGAACCGCCAACAACACCGGCGAAGTCGCGTCTCCCCTGCCCCTTGGTAGCGGTACCGACACCGGCGAGATGCGTCTCCAGTCCGACTTCGTGC
TCGCCCGCGACTCGCGCACTGCGTGCTTCTGGCAGGGCTTTGTCAACGAGCAGGAGTTCATGGCTGCGTCGTTCAAGGCCGCGATGGCAAAGCTCGCGGTGCTCGGCCACAACCGCAACG
CGCTCATCGACTGCTCCGACGTCGTCCCTACGCCCAAGCCCGCCGTCGGCACGCCAGCGTCGTTCCCCGCCACGACCGGCCCCCAGGACCTCGAGCTCTCGTGCAACACCGCTCGCTTCC
CCAAGCTCGCCGTCCAGG
CCGGCACCGAGCAGGCTATCATTCCTCACTGCTCCACCGGTGGCATGTCTTGCCCCGGCGTCGACTTCGACGGCCCCGCTCAGGATAGCTCCTAA

Retrieve as FASTA