Entry information : PgigMnP[P]06
Entry ID 9666
Creation 2011-11-09 (Christophe Dunand)
Last sequence changes 2012-03-27 (Catherine Mathe (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: PgigMnP[P]06
Name PgigMnP[P]06
Class Manganese peroxidase     [Orthogroup: MnP001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP[P]06
start..stop
S start..stop
PgigMnP06 315 3e-109 1..180 1..179
CsuMnP05 293 2e-100 1..181 1..178
CsuMnP04 292 3e-100 1..181 1..178
PstrMnP08 291 8e-100 1..181 1..182
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158271..158399 129 N° 2 158454..158505 52 N° 3 158558..158584 27 N° 4 158641..158680 40
N° 5 158733..158907 175 N° 6 158966..159085 120  
join(158271..158399,158454..158505,158558..158584,158641..158680,158733..158907, 158966..159085)


exon

Literature and cross-references PgigMnP[P]06
DNA ref. JGI genome:   scaffold_19 (158271..159085)
Protein sequence: PgigMnP[P]06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181 (163)
PWM (Da):   %s   18423.17 (16732.3)  
PI (pH):   %s   4.2 (4.20) Peptide Signal:   %s   cut: 19 range:19-181
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLFALAGLAAVVSAAPAAETAVCPDGTRVSNAACCAFIPLAQDLQDNLFQGDCGEDAHEAIRLTFHDAIAISRSQGSAAGGGADGSMLLFPTVEPLFVANNGISDSVNNLLHFLPLHPVSAGDLVQFAGAVALSNCGAPQLEFLAGRPNKTFAAVDGLIPEPQDSVTKILARFEDA

Retrieve as FASTA  
Remarks Pseudogene, only the first 5 exons have been found (=>"n" after)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCATCCCTCTTCGCACTGGCTGGTCTCGCCGCGGTTGTCAGTGCCGCCCCCGCTGCTGAGACCGCCGTCTGCCCCGACGGCACTAGGGTCTCCAACGCGGCATGCTGCGCT
TTCATCCCT
GTAAGCGTCGACTTGTGCGTACCGATGGTCAAAAACTAACTCGACGTTACACAGCTCGCTCAGGACCTCCAAGACAACCTTTTCCAGGGCGACTGCGGTGAAGATGGTATG
TCCTCTCGAACCGATGCGGAGTACAAGTTACTCATCCACTTCCACAGCTCACGAAGCTATCCGTCTGACTTTCCGTACGCGCTGCTTGACATATTAGAGAACTAGTTCGTAGACTAACAC
CTCACTCTAGACGACGCCATTGCTATCTCTCGTAGCCAGGGCTCCGCAGCGTATGTCCCTCTCACACCAACGGGGATTTTCCATTAACGTGGTCTTTTACAGCGGCGGAGGTGCCGACGG
CTCCATGCTCCTCTTCCCGACGGTTGAGCCTCTGTTCGTGGCCAACAATGGTATCTCTGACAGCGTGAACAACCTCCTACACTTCCTGCCTCTCCACCCGGTCAGTGCTGGCGACCTGGT
CCAGTTTGCTGGTGCCGTCGCCCTCTCCAACTGCCCT
GTATGCCACATTTTCCCCTTAACTTACATCCGTGGCTCTGACGACAGACATTTCATAGGGTGCTCCTCAGCTCGAGTTCCTGG
CTGGTCGCCCGAACAAGACATTCGCTGCCGTCGACGGCCTCATTCCTGAGCCTCAGGACAGCGTCACCAAGATTCTCGCGCGTTTCGAGGATGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCATCCCTCTTCGCACTGGCTGGTCTCGCCGCGGTTGTCAGTGCCGCCCCCGCTGCTGAGACCGCCGTCTGCCCCGACGGCACTAGGGTCTCCAACGCGGCATGCTGCGCT
TTCATCCCT
CTCGCTCAGGACCTCCAAGACAACCTTTTCCAGGGCGACTGCGGTGAAGATGCTCACGAAGCTATCCGTCTGACTTTCCACGACGCCATTGCTATCTCTCGTAGCCAGGGC
TCCGCAGC
CGGCGGAGGTGCCGACGGCTCCATGCTCCTCTTCCCGACGGTTGAGCCTCTGTTCGTGGCCAACAATGGTATCTCTGACAGCGTGAACAACCTCCTACACTTCCTGCCTCTC
CACCCGGTCAGTGCTGGCGACCTGGTCCAGTTTGCTGGTGCCGTCGCCCTCTCCAACTGCCCT
GGTGCTCCTCAGCTCGAGTTCCTGGCTGGTCGCCCGAACAAGACATTCGCTGCCGTC
GACGGCCTCATTCCTGAGCCTCAGGACAGCGTCACCAAGATTCTCGCGCGTTTCGAGGATGCC

Retrieve as FASTA