1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx317
Entry ID 9668
Creation 2011-11-10 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li (Scipio))
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx317
Name GmPrx317
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx317
start..stop		 S start..stop
GmPrx327 271 3.05e-92 1..158 150..307
GmPrx31 270 3.41e-92 1..158 151..308
IaquPrx23 212 2.6e-69 1..158 155..312
InPrx73 211 1.11e-68 1..158 160..317
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx317
DNA ref. Phytozome 12:   Gm01 (35354005..35189620)
Protein sequence: GmPrx317
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   180
PWM (Da):   %s   20138.96  
PI (pH):   %s   10.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VRLGRMDSKIAHFTVANTGVIPPPTSNLTNLMTRFRDQGxSATDMVSLAGAHTFGKGRCTSFGYCIYNQTNNDKTFALTRQRRCPRTNGTGDNNLENLDLRTPNHFDNNYFKNLLIERGL
LNSNQVFFNGGSTDSLIKIYSQNNKAFDSSFLKAMIRMMICKREVHNIYNCIQARSHVEL

Retrieve as FASTA  
Remarks Partial sequence from genomic. No prediction from phytozome (Both long 5' end and short 3' end are missing due to the 'nnnnnnnnn' which are not found).
DNA ►
Send to BLAST
CDS►
Send to BLAST