Entry information : GmPrx[P]99
Entry ID 9669
Creation 2011-11-10 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: GmPrx[P]99
Name GmPrx[P]99
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]99
start..stop
S start..stop
GmPrx274 491 5e-177 4..304 18..317
GmPrx27 399 7e-141 4..304 18..322
GmPrx273 396 9e-140 4..304 18..322
MtPrx25 369 5e-129 1..304 15..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25125124..25125288 165 N° 2 25124687..25124878 192 N° 3 25124213..25124377 165 N° 4 25123641..25124025 385
complement(join(25123641..25124025,25124213..25124377,25124687..25124878,2512512 4..25125288))


exon

Literature and cross-references GmPrx[P]99
DNA ref. Phytozome 12:   Gm19 (25125288..25123641)
Protein sequence: GmPrx[P]99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   298
PWM (Da):   %s   32364.18  
PI (pH):   %s   5.32
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AFAPLCLCNLNPQFYDNSCPQAQPIVNSILTLYVVIQPGYATQILRLHFRDCFVMGCDGLLLLDSSESIVSEKESNPNCDSARGFIVIHAIKLALERACPSIVS*ADILTIAARDSVVLTSGTS*EVPLGRIDS*EASISGSNNNIPVPNITFQTLQTKFEQ*GFNLTDLVARSGTHTIGIARCTNFM*RLYNQSGNGEPGSTLDQNYSALLRPTCPRxTLGDQNPFFIDYATPLKYWxNSYFKNLKENKGLLNSGQLLFTMNQE*TELVRLNAEGNGLFFEQFSKSMIKMGNISPLTNSSGEI

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome. 5' end and 3' end are missing. Stops in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCCCTTGTGCCTCTGTAACCTTAATCCTCAGTTTTATGACAATTCATGCCCTCAAGCTCAGCCAATTGTGAATTCCATTCTTACCTTGTATGTTGTAATTCAACCCGGATATGCAAC
TCAAATTCTCAGGCTTCATTTTCGTGATTGTTTTGTCATGGTCTC
TCCCTATGACTTGCCAACAAACTTAGTGGTTTATTGCACAACAACATCACATTATTAACATTGTAATATCATAAA
TAATTATACGATGTTAGTACTTAGTCTTATTGGTAACATAGTTGCATTATCATGTGATCAATGTTAATGCATAGTACTTAGTCTTATTAGTAAACATATAATAGTTAATTATGTTATATC
CAGTAGTTCTTTATTCAAATGCTTAATTCAAGGTTGATGTAGTAGGGTTGTGATGGTTTGTTGTTGTTAGATAGCAGTGAAAGCATTGTCAGTGAGAAGGAATCAAATCCCAACTGTGAT
TCAGCTAGAGGATTTATAGTCATTCATGCAATTAAACTGGCACTAGAGAGAGCATGCCCTTCTATAGTGTCTTGAGCTGACATCTTGACTATTGCTGCAAGGGATTCAGTTGTTCTTGTA
AG
CATCTGCTTATGAGAGATTTAGTTAATTGGTTTGAAAAAATNNNNNNNNNNNNNNNNNNNNNNNNNAAAAATACTATAAAAGTTTGTGCATGAAATAGTAAAATAAGTTTAATTTTTT
TCCTATTTTCCATACAAACAAAAAATAAAGTAAAACAAAATGATATTTTTGTAATTAAAAGTGGAAATAAAAAATAAAAAATAGAAAATTTTTTGTCAAATTAAACTGTTTGTAATTAAC
CTTTCACTATCAAAACTTTTTCATTTTTATCAAGCCTAATTCACTATATATCCCTTTTATGTATAGACTAGTGGAACAAGCTAGGAAGTACCCTTAGGAAGAATTGACTCTTGAGAAGCA
AGCATAAGTGGCTCCAACAACAACATTCCAGTCCCAAATATCACATTCCAAACCCTCCAAACAAAATTCGAGCAATAGGGGTTTAACCTTACTGATCTAGTTGCTCGATCTATTTG
GTAT
ACTCCTTAAACTTGTCTATTTCGAATTCTATTTAGATAAATTTTTCTAAAAATACTTATAAAAGAAAAGGAATGAGAAAAAAATAAAAGAGAAATTCCACATGTTGTCATGCATAAACTT
GAGTCAAAGTTATCTCAATGTCATTTTCTAAACAATTTTTGTACAAATGCTACATATAGGGACCCATACTATAGGAATTGCTAGGTGCACCAACTTCATGTAAAGACTCTACAACCAAAG
TGGAAATGGCGAGCCAGGCTCCACTCTTGACCAAAACTATTCTGCTTTGTTGCGTCCTACGTGTCCAAGGNNNACTTTGGGTGACCAGAATCCATTCTTCATAGACTACGCCACACCACT
TAAATATTGGCNNAATAGCTACTTTAAGAACCTGAAGGAAAACAAGGGTCTATTAAATTCTGGTCAACTTCTCTTCACAATGAATCAAGAATGAACTGAGTTAGTGAGGTTGAATGCTGA
AGGAAACGGCCTTTTCTTTGAACAATTCTCCAAGTCCATGATCAAGATGGGAAACATTTCTCCTTTGACGAATTCTAGTGGAGAGATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCCCTTGTGCCTCTGTAACCTTAATCCTCAGTTTTATGACAATTCATGCCCTCAAGCTCAGCCAATTGTGAATTCCATTCTTACCTTGTATGTTGTAATTCAACCCGGATATGCAAC
TCAAATTCTCAGGCTTCATTTTCGTGATTGTTTTGTCATGGTCTC
TGATGGTTTGTTGTTGTTAGATAGCAGTGAAAGCATTGTCAGTGAGAAGGAATCAAATCCCAACTGTGATTCAGC
TAGAGGATTTATAGTCATTCATGCAATTAAACTGGCACTAGAGAGAGCATGCCCTTCTATAGTGTCTTGAGCTGACATCTTGACTATTGCTGCAAGGGATTCAGTTGTTCTTGTAAG
TGG
AACAAGCTAGGAAGTACCCTTAGGAAGAATTGACTCTTGAGAAGCAAGCATAAGTGGCTCCAACAACAACATTCCAGTCCCAAATATCACATTCCAAACCCTCCAAACAAAATTCGAGCA
ATAGGGGTTTAACCTTACTGATCTAGTTGCTCGATCTATTTG
CCATACTATAGGAATTGCTAGGTGCACCAACTTCATGTAAAGACTCTACAACCAAAGTGGAAATGGCGAGCCAGGCTC
CACTCTTGACCAAAACTATTCTGCTTTGTTGCGTCCTACGTGTCCAAGGNNNACTTTGGGTGACCAGAATCCATTCTTCATAGACTACGCCACACCACTTAAATATTGGCNNAATAGCTA
CTTTAAGAACCTGAAGGAAAACAAGGGTCTATTAAATTCTGGTCAACTTCTCTTCACAATGAATCAAGAATGAACTGAGTTAGTGAGGTTGAATGCTGAAGGAAACGGCCTTTTCTTTGA
ACAATTCTCCAAGTCCATGATCAAGATGGGAAACATTTCTCCTTTGACGAATTCTAGTGGAGAGATC

Retrieve as FASTA