Entry information : GmAPx[P]21
Entry ID 9678
Creation 2011-11-10 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmAPx[P]21
Name GmAPx[P]21
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]21
start..stop
S start..stop
GmAPx[P]16 187 1.04e-63 1..100 1..100
GmAPx[P]19 179 8.3e-61 1..100 1..100
GmAPx[P]12 172 3.48e-58 1..100 1..100
GmAPx01 150 2.42e-47 1..99 5..120
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9678' 'complement(join(26340498..26340569,26340628..26340752,26340854..26340957))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26340854..26340957 102 N° 2 26340628..26340752 123 N° 3 26340498..26340569 70  
complement(join(26340498..26340569,26340628..26340752,26340854..26340957))


exon

Literature and cross-references GmAPx[P]21
DNA ref. Phytozome 12:   Gm18 (26340957..26340498)
Protein sequence: GmAPx[P]21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   100
PWM (Da):   %s   10888.72  
PI (pH):   %s   9.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YHLVFPLCQKAVEKTKKLRGFIAEKRCAPLMLCLAWHFAGTFDKGTNTGRPFGxIAIRLLESLKAEFPILSYADFYPLAGIVAMEVTGGPEVPFHPGREV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Just a short PS with gaps in it. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCATTTGGTTTTTCCCCTTTGTCAGAAGGCCGTTGAGAAGACAAAGAAGCTCAGAGGCTTCATCGCTGAGAAGAGATGCGCTCCTCTAATGCTCTGTTTGGCGTGCATTTTTTTTATTTT
TTTATTTAACATTAGATCACTGTTATTTACAATTGAGTTTATGGATTATCGTTTTGACGCGTTTTGGTGTGTTTCGTGTGCAGATGGGGCACTTTGCTGGAACCTTTGACAAGGGCACAA
ACACTGGTCGACCCTTCGGACNNATCGCTATTAGGCTTTTGGAGTCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACCCG
GTGATGTTTTTTTGTCTTTGGTGTTTGT
GCGCTTAATGTTGTGTTTGTGTTGACGCAGTTTTGGCTGGCATTGTTGCCATGGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCATTTGGTTTTTCCCCTTTGTCAGAAGGCCGTTGAGAAGACAAAGAAGCTCAGAGGCTTCATCGCTGAGAAGAGATGCGCTCCTCTAATGCTCTGTTTGGCGTGGCACTTTGCTGGAAC
CTTTGACAAGGGCACAAACACTGGTCGACCCTTCGGACNNATCGCTATTAGGCTTTTGGAGTCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACCCG
TTGGCTGGCAT
TGTTGCCATGGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTATAA

Retrieve as FASTA