Entry information : PbreMnP05 ( MnP5-long)
Entry ID 9687
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2012-10-01 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: PbreMnP05 ( MnP5-long)
Name (synonym) PbreMnP05 ( MnP5-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreMnP05
start..stop
S start..stop
PbreMnP01 676 0 1..382 1..382
PbreMnP04 670 0 1..381 1..381
PbreMnP07 665 0 1..382 1..382
PbreMnP03 660 0 1..382 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64145..64270 126 N° 2 64332..64383 52 N° 3 64445..64471 27 N° 4 64537..64576 40
N° 5 64638..65037 400 N° 6 65096..65143 48 N° 7 65736..65889 154 N° 8 65951..66086 136
N° 9 66145..66221 77 N° 10 66279..66364 86  
join(64145..64270,64332..64383,64445..64471,64537..64576,64638..65037,65096..651 43,65736..65889,65951..66086,66145..66221,66279..66364)


exon

Literature and cross-references PbreMnP05 ( MnP5-long)
DNA ref. JGI genome:   scaffold_32 (64145..66364)
Protein sequence: PbreMnP05 ( MnP5-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (364)
PWM (Da):   %s   39820.59 (38015.6)  
PI (pH):   %s   4.01 (4.01) Peptide Signal:   %s   cut: 19 range:19-382
Sequence 423
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLLALIALAAYIAASPAPTATCSDGTRVSNEACCAFIPLAQDLQNTIFQGDCGEDAHEVIRLTFHDAIAISQSLGPSAGGGADGSMLIFPLVEPEFSANNGIDDSVNNLIPFIAKHPTITAGDLVQFAGAVALSNCPGAPQIEFLAGRPNATAPAVDGLIPEPQDNVTSLLDRFADAGNFSPFEVISLLASHSIARADKVDETIDAAPFDTTPFTFDTQVFLEVLLRGVGFPGTPNNTGEVESPLPIGSGTDTGELRLQSDFALARDERTACFWQGFVNEQELMASSFKAAMAKLAILGHNRNDLIDCSEVVPVPKPAVNKPASFPATTGPEDLQLTCATMKFPTLTVDPGATETLIPHCSDGSMNCTTVQFSGPATD

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCATTCACCTCGCTCCTCGCACTTATTGCTCTCGCGGCGTACATCGCTGCCTCACCCGCACCCACCGCTACCTGCTCTGATGGTACTCGTGTCTCCAACGAGGCGTGCTGCGCTTTTA
TTCCT
GTATGTATTATGGCCACCACAACTCTTGACCACGTTTTTGACACAAATGCTTGCGCCACAGCTTGCCCAGGATCTGCAGAACACCATATTCCAGGGCGATTGCGGTGAAGACGGT
AAGACTTATCACTGTGTGGCGTACTAGTGTTGATACTGTGCTCACAACTATATTCGTAGCACATGAGGTCATTCGTTTGACTTTCCGTGAGTCTAACAAAGCGAACTTTAACTGGAACTA
AGCGAAACTGATGTCATTTTGCGACTTCTAGATGACGCGATCGCTATCAGTCAAAGCTTGGGTCCTTCCGCGTGAGCACTGCCACAATTCATCAACAAAAACAACACAACTGATCGCGAT
TGTGATGACCAGCGGCGGGGGCGCAGACGGCTCCATGCTCATCTTCCCGCTCGTCGAGCCTGAGTTCTCCGCAAACAACGGCATCGATGATAGCGTGAACAACCTGATCCCCTTCATCGC
CAAGCACCCGACGATCACCGCAGGCGACCTCGTCCAGTTCGCAGGCGCGGTCGCGCTGAGCAACTGCCCGGGCGCGCCTCAGATCGAGTTCCTGGCGGGACGCCCGAACGCCACTGCCCC
CGCCGTCGACGGGCTGATCCCCGAGCCGCAGGACAACGTGACGAGTCTGCTCGATCGCTTCGCGGACGCGGGAAACTTCTCGCCGTTCGAGGTCATCTCGCTCCTGGCGTCGCACAGTAT
CGCGCGTGCAGATAAGGTCGACGAGACGATCGACGCCGCGCCCTTCGATACG
GTCAGTCCTCCATGCTATACCCATGCCAACCACAGCTCATCCTGACGAACTTGAACAGACGCCATTCA
CGTTCGACACCCAGGTCTTCCTGGAAGTCCTGCTCAGG
GTAAATAATCCCGCTTTCGCAGCAAATTGGGAGAGGTAACTGATGAGTATGGCATGCGCACAGGGCGTCGGGTTCCCCGGGA
CGCCAAACAACACCGGCGAGGTCGAGTCTCCGCTCCCCATCGGCTCCGGCACGGACACCGGCGAGCTGCGTCTCCAGTCCGACTTTGCGCTCGCGCGCGACGAGCGCACGGCGTGCTTCT
GGCAGGGCTTCGTCAGTACGTACTCCTCATCTGCGCTCACCTCCGGTCGCACCGCATTGCTGACGCCGTCCCTTAGACGAGCAGGAGCTCATGGCCTCGAGCTTCAAGGCCGCGATGGCG
AAGCTCGCGATCCTCGGGCACAATCGCAACGACCTGATTGACTGCTCCGAAGTCGTTCCCGTGCCGAAGCCCGCCGTCAACAAGCCCGCGTCGTACGTACTGTCTCATAACGCCCCGTAC
TCCTTCGCTGACTCGGACTCGCGANNNNNNNNNNNNNNNNNNNNATTCACGTTCGACACCCAGGTCTTCCTGGAAGTCCTGCTCAGGGTAAATAATCCCGCTTTCGCAGCAAATTGGGAG
AGGTAACTGATGAGTATGGCATGCGCACAGGGCGTCGGGTTCCCCGGGACGCCAAACAACACCGGCGAGGTCGAGTCTCCGCTCCCCATCGGCTCCGGCACGGACACCGGCGAGCTGCGT
CTCCAGTCCGACTTTGCGCTCGCGCGCGACGAGCGCACGGCGTGCTTCTGGCAGGGCTTCGTCA
GTACGTACTCCTCATCTGCGCTCACCTCCGGTCGCACCGCATTGCTGACGCCGTCC
CTTAGACGAGCAGGAGCTCATGGCCTCGAGCTTCAAGGCCGCGATGGCGAAGCTCGCGATCCTCGGGCACAATCGCAACGACCTGATTGACTGCTCCGAAGTCGTTCCCGTGCCGAAGCC
CGCCGTCAACAAGCCCGCGTC
GTACGTACTGTCTCATAACGCCCCGTACTCCTTCGCTGACTCGGACTCGCGATGTTAGATTCCCGGCGACCACAGGCCCGGAGGATCTTCAGCTCACCT
GTGCGACGATGAAGTTCCCCACGCTCACCGTGGATC
GTAAGTGCCTTTGTTGTTTCTCCGCTTTCTGAGTGTTGGCTCACGTTATGGTTACAGCTGGTGCCACAGAGACGCTCATCCCGC
ACTGCTCGGACGGCAGCATGAACTGCACGACCGTCCAGTTCTCTGGTCCCGCCACTGAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCATTCACCTCGCTCCTCGCACTTATTGCTCTCGCGGCGTACATCGCTGCCTCACCCGCACCCACCGCTACCTGCTCTGATGGTACTCGTGTCTCCAACGAGGCGTGCTGCGCTTTTA
TTCCT
CTTGCCCAGGATCTGCAGAACACCATATTCCAGGGCGATTGCGGTGAAGACGCACATGAGGTCATTCGTTTGACTTTCCATGACGCGATCGCTATCAGTCAAAGCTTGGGTCCTT
CCGC
CGGCGGGGGCGCAGACGGCTCCATGCTCATCTTCCCGCTCGTCGAGCCTGAGTTCTCCGCAAACAACGGCATCGATGATAGCGTGAACAACCTGATCCCCTTCATCGCCAAGCACC
CGACGATCACCGCAGGCGACCTCGTCCAGTTCGCAGGCGCGGTCGCGCTGAGCAACTGCCCGGGCGCGCCTCAGATCGAGTTCCTGGCGGGACGCCCGAACGCCACTGCCCCCGCCGTCG
ACGGGCTGATCCCCGAGCCGCAGGACAACGTGACGAGTCTGCTCGATCGCTTCGCGGACGCGGGAAACTTCTCGCCGTTCGAGGTCATCTCGCTCCTGGCGTCGCACAGTATCGCGCGTG
CAGATAAGGTCGACGAGACGATCGACGCCGCGCCCTTCGATACG
ACGCCATTCACGTTCGACACCCAGGTCTTCCTGGAAGTCCTGCTCAGGGGCGTCGGGTTCCCCGGGACGCCAAACA
ACACCGGCGAGGTCGAGTCTCCGCTCCCCATCGGCTCCGGCACGGACACCGGCGAGCTGCGTCTCCAGTCCGACTTTGCGCTCGCGCGCGACGAGCGCACGGCGTGCTTCTGGCAGGGCT
TCGTCA
ACGAGCAGGAGCTCATGGCCTCGAGCTTCAAGGCCGCGATGGCGAAGCTCGCGATCCTCGGGCACAATCGCAACGACCTGATTGACTGCTCCGAAGTCGTTCCCGTGCCGAAGC
CCGCCGTCAACAAGCCCGCGTC
ATTCCCGGCGACCACAGGCCCGGAGGATCTTCAGCTCACCTGTGCGACGATGAAGTTCCCCACGCTCACCGTGGATCCTGGTGCCACAGAGACGCTCA
TCCCGCACTGCTCGGACGGCAGCATGAACTGCACGACCGTCCAGTTCTCTGGTCCCGCCACTGAC

Retrieve as FASTA