Entry information : LmaCIIAC02
Entry ID 9696
Creation 2011-10-27 (Christophe Dunand)
Last sequence changes 2011-11-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-04-09 (Christophe Dunand)
Peroxidase information: LmaCIIAC02
Name LmaCIIAC02
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Leptosphaeriaceae Leptosphaeria
Organism Leptosphaeria maculans    [TaxId: 5022 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LmaCIIAC02
start..stop
S start..stop
AbraCIIAC02 504 0 1..348 1..348
PterCIIAC01 494 2.34e-177 12..348 12..348
PtritCIIAC01 493 5.97e-177 12..348 12..348
AalteCIIAC02 487 1.77e-174 1..348 1..347
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9696' 'complement(join(1474802..1475601,1475647..1475893))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1475647..1475893 245 N° 2 1474802..1475601 798  
complement(join(1474802..1475601,1475647..1475893))


exon

Literature and cross-references LmaCIIAC02
Protein ref. UniProtKB:   E5A4C7 [Incorrect splicing]
DNA ref. JGI genome:   lm_SuperContig_14_v2 (1475893..1474802)
Protein sequence: LmaCIIAC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (328)
PWM (Da):   %s   37796.33 (35856.2)  
PI (pH):   %s   7.2 (6.94) Peptide Signal:   %s   cut: 21 range:21-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSPKTVLAASLVLSSVATANPLDRREASPGLIEDLLNIALTPIT
NLISNVLSGSITAIDNTISSKPLTCSLSIFAPDKCCV
WWDVSAELTRRFKESNGTCNDNARAAIRMGFHDAGAWDKNSPSGGADGSLLMDFGEINRPENNGLQSIRTLLRGVQSQYRVGYADLVQYAHNHASISCPKGPRVRTFIGRQDATRAPPDG
LLPDVHDDPDKIIALFENKGIDAHDLAALLGAHATARQRFVDTRPVAVNKPLDTTIGVWDVEFYNDTLNNAAGSSATQKVFVLPSDKALSKHPKLTDEWKSFVGDQQHWNEDYAKAYVRL
SLLGVKNLQNLVDCTKTLPPSRKTFP

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). incorrect prediction from JGI (extra sequence in 5').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTCCAAAGACAGTGTTAGCCGCTTCCCTTGTGCTTTCTTCCGTCGCAACCGCCAATCCTCTTGACCGTCGCGAAGCGAGTCCGGGACTTATTGAGGACCTCCTCAATATTGCT
CTTACCCCAATTACAAATTTGATCTCGAATGTACTTAGCGGATCGATAACTGCCATCGACAACACCATATCCAGCAAACCCCTAACGTGCTCACTATCGATTTTTGCGCCTGACAAGTGC
TGCGTTT
GTAAGTTGTTCGGCTTCCTACTCTTGGGCCTTGGTAACAGTTTAGGGGGTGGGATGTGTCTGCTGAGCTCACGAGGAGATTTAAAGAATCAAACGGCACGTGCAATGACAATG
CTCGAGCTGCTATTCGCATGGGATTCCACGATGCCGGAGCATGGGACAAGAACTCACCCAGCGGTGGCGCAGACGGCTCCCTCCTCATGGACTTTGGCGAGATCAATCGACCGGAGAATA
ACGGCCTGCAAAGCATACGGACACTGCTCCGGGGTGTGCAGTCGCAATACAGGGTTGGATATGCCGACCTCGTACAATATGCTCACAACCACGCGAGCATCTCCTGTCCCAAGGGCCCCC
GCGTCCGCACCTTTATCGGCCGTCAAGATGCTACCCGAGCGCCTCCGGATGGCCTGCTACCCGATGTTCACGACGACCCCGACAAGATCATTGCACTCTTTGAAAACAAGGGGATTGACG
CGCACGATCTTGCCGCACTTCTCGGGGCTCATGCAACGGCGCGACAACGTTTCGTCGACACGCGGCCCGTAGCCGTCAACAAGCCGCTTGACACAACCATTGGCGTATGGGATGTCGAGT
TCTACAACGACACTCTGAACAATGCTGCTGGGAGTTCGGCAACGCAAAAGGTGTTTGTGCTGCCATCGGACAAGGCGTTGTCCAAGCATCCAAAACTCACCGACGAGTGGAAGTCGTTTG
TGGGCGATCAGCAACATTGGAACGAAGACTACGCGAAGGCGTATGTAAGGCTGAGTCTGCTCGGCGTAAAGAATTTGCAGAATCTGGTCGATTGCACAAAGACTCTGCCGCCCAGTAGGA
AGACTTTTCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTCCAAAGACAGTGTTAGCCGCTTCCCTTGTGCTTTCTTCCGTCGCAACCGCCAATCCTCTTGACCGTCGCGAAGCGAGTCCGGGACTTATTGAGGACCTCCTCAATATTGCT
CTTACCCCAATTACAAATTTGATCTCGAATGTACTTAGCGGATCGATAACTGCCATCGACAACACCATATCCAGCAAACCCCTAACGTGCTCACTATCGATTTTTGCGCCTGACAAGTGC
TGCGTTT
GGTGGGATGTGTCTGCTGAGCTCACGAGGAGATTTAAAGAATCAAACGGCACGTGCAATGACAATGCTCGAGCTGCTATTCGCATGGGATTCCACGATGCCGGAGCATGGGAC
AAGAACTCACCCAGCGGTGGCGCAGACGGCTCCCTCCTCATGGACTTTGGCGAGATCAATCGACCGGAGAATAACGGCCTGCAAAGCATACGGACACTGCTCCGGGGTGTGCAGTCGCAA
TACAGGGTTGGATATGCCGACCTCGTACAATATGCTCACAACCACGCGAGCATCTCCTGTCCCAAGGGCCCCCGCGTCCGCACCTTTATCGGCCGTCAAGATGCTACCCGAGCGCCTCCG
GATGGCCTGCTACCCGATGTTCACGACGACCCCGACAAGATCATTGCACTCTTTGAAAACAAGGGGATTGACGCGCACGATCTTGCCGCACTTCTCGGGGCTCATGCAACGGCGCGACAA
CGTTTCGTCGACACGCGGCCCGTAGCCGTCAACAAGCCGCTTGACACAACCATTGGCGTATGGGATGTCGAGTTCTACAACGACACTCTGAACAATGCTGCTGGGAGTTCGGCAACGCAA
AAGGTGTTTGTGCTGCCATCGGACAAGGCGTTGTCCAAGCATCCAAAACTCACCGACGAGTGGAAGTCGTTTGTGGGCGATCAGCAACATTGGAACGAAGACTACGCGAAGGCGTATGTA
AGGCTGAGTCTGCTCGGCGTAAAGAATTTGCAGAATCTGGTCGATTGCACAAAGACTCTGCCGCCCAGTAGGAAGACTTTTCCTTAG

Retrieve as FASTA