Entry information : PbreLiP01 (LiP1)
Entry ID 9699
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2016-06-06 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-17 (Christophe Dunand)
Peroxidase information: PbreLiP01 (LiP1)
Name (synonym) PbreLiP01 (LiP1)
Class Lignin peroxidase    [Orthogroup: LiP005]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreLiP01
start..stop
S start..stop
PbreLiP05 588 0 23..363 16..359
PrLiP04 521 0 25..366 20..361
PrLiP03 503 2e-180 6..366 1..361
PbreLiP03 485 2e-173 1..363 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 296721..296781 61 N° 2 296838..297048 211 N° 3 297100..297234 135 N° 4 297284..297351 68
N° 5 297407..297418 12 N° 6 297468..297509 42 N° 7 297562..297640 79 N° 8 297693..297818 126
N° 9 297873..297942 70 N° 10 298001..298046 46 N° 11 298112..298284 173 N° 12 298343..298407 65
N° 13 298461..298473 13  
join(296721..296781,296838..297048,297100..297234,297284..297351,297407..297418, 297468..297509,297562..297640,297693..297818,297873..297942,298001..298046,29811 2..298284,298343..298407,298461..298473)


exon

Literature and cross-references PbreLiP01 (LiP1)
DNA ref. JGI genome:   scaffold_26 (296721..298473)
Protein sequence: PbreLiP01 (LiP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (345)
PWM (Da):   %s   39038.24 (36672.0)  
PI (pH):   %s   4.04 (3.97) Peptide Signal:   %s   cut: 22 range:22-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFFKQLALAVLLSFAFPAANAGPASIQRRTTCADGNVVANGGCCALFRVRDDLQNNLFNNECGDEAHEAIRLTFHDAIAISPALEAEGQFGGGGADGSIILFSRTETAFQANVGLDEVVETEIPFLERSGMGVADFIQFAGAVALTNCPGAPVLNVSIGRVDATRAAPDGLVPEPFDDVDKILNRFNDAGEFDELETVWFLIAHSVAAQNDIDPTIPRTPFDSTPSIMDGQFFIETQLKGLGFPGDDPGEGEALSPLAGEFRLQSDFLLARDNRTACEWQSFGTDQAKLQNRFQFIFQAMGQLGQNVSNLIDCSDVLAIPPPLTTTPHLPAGKTLDDVQPACADTPFPSLTADPGPATRVATVPRD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTCAAGCAACTCGCTCTCGCTGTTCTTCTTTCTTTCGCCTTCCCGGCTGCGAACGGTACTCCCTAATCTTACATCTCTAGCATGCATGCCCCTCACCCAAATTCCTTCCAGCTG
GCCCCGCTAGCATTCAGAGGCGTACGACCTGCGCTGATGGAAATGTCGTCGCGAACGGCGGATGTTGTGCCTTGTTCCGCGTCCGTGACGACCTCCAGAACAACCTTTTCAACAACGAAT
GTGGTGACGAGGCTCATGAGGCGATCCGTCTGACCTTTCATGACGCCATCGCCATCTCGCCCGCCCTCGAAGCCGAAGGACAATTCGG
GTATGTTTAGATTCCTCTCTCACTGATCACTC
CGCTAATGAACCACTATAGAGGCGGAGGGGCCGATGGCTCCATTATTCTCTTCTCCAGGACCGAGACCGCGTTCCAAGCGAATGTTGGCCTTGACGAGGTCGTCGAGACAGAGATCCCCT
TCTTGGAGAGGAGTGGTATGGGTGTCGCTGACTT
GTAGGTCCTCGAGCATGCCTAGTACTATACGATCTGAGTCTTTTCTTAGCATTCAGTTCGCTGGTGCAGTTGCTCTCACCAATTGT
CCTGGTGCCCCTGTCCTGAACGTATCCATTG
GTGAGTTCTCTAACCTCTTTATGCCTTGGAAACTATTATTGATATGTCAACACAGGCCGTGTGGACGGTATGTGCGATTCTGAGTAGTC
CTCGCATTACTAACTCGTCGTCTTCAGCTACTCGAGCAGCTCCTGACGGCCTCGTCCCTGAGCCTTTCGGTGAGATATCGTTGTTATTGCCGACATAACCTTGCACTAATTGATGATGCA
GACGATGTTGACAAGATTCTCAACCGCTTCAACGACGCCGGGGAATTTGATGAGCTTGAGACGGTTTGGTTCTTGATCGCGTAAGCCACAGTTCCCATTCGTAGCGCTACAAGCAATTAA
CTGCCTTAACAGACACTCTGTTGCCGCTCAGAATGATATTGATCCAACTATCCCGCGCACGCCATTTGATTCTACACCGTCGATCATGGATGGCCAATTCTTCATCGAGACACAATTGAA
GGGCCTCGGCTTCCCTGG
GTGAGCTCCTAATGCAGCGGTTGCACAGTCGGGTACTAATGTATATACCAACAGTGACGATCCTGGTGAAGGAGAGGCACTTAGTCCGCTCGCAGGGGAGTT
CCGTCTCCAATCCGACTTCTTG
GTGCGTAGATGCGTATTACGTCTGTCACGAGATCACTATTGCTCATACACACATATAGCTTGCACGCGATAACAGGACGGCGTGTGAATGGCAGTCTT
TCGGAA
GTGAGTGGGCGGTCCCACATTCCCTTTTCCAAAAAGTGATGATTGAATGCCCGTCCTGTGCTTAGCGGACCAAGCCAAACTCCAGAACCGCTTCCAGTTCATCTTCCAGGCGAT
GGGCCAGCTCGGTCAGAACGTATCCAACTTGATCGATTGCAGCGATGTTCTCGCCATCCCGCCGCCTCTGACTACCACTCCCCACCTCCCTGCTGGCAAGACTTTGGACGATGTTCAGCC
CGCT
GTGCGTATTCGCTTTTGTCATGACATTCGCAGCTGACTGACATTTGTGCGACACATAGTGTGCCGACACTCCTTTCCCTTCTCTCACCGCGGACCCCGGCCCCGCCACCCGGGTCG
CCACTGT
GTACGTGATGGCAACTTATCGGCGTAATATATCGGCTCACTGAACCTTTTCAGTCCGAGGGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTCAAGCAACTCGCTCTCGCTGTTCTTCTTTCTTTCGCCTTCCCGGCTGCGAACGCTGGCCCCGCTAGCATTCAGAGGCGTACGACCTGCGCTGATGGAAATGTCGTCGCGAAC
GGCGGATGTTGTGCCTTGTTCCGCGTCCGTGACGACCTCCAGAACAACCTTTTCAACAACGAATGTGGTGACGAGGCTCATGAGGCGATCCGTCTGACCTTTCATGACGCCATCGCCATC
TCGCCCGCCCTCGAAGCCGAAGGACAATTCGG
AGGCGGAGGGGCCGATGGCTCCATTATTCTCTTCTCCAGGACCGAGACCGCGTTCCAAGCGAATGTTGGCCTTGACGAGGTCGTCGAG
ACAGAGATCCCCTTCTTGGAGAGGAGTGGTATGGGTGTCGCTGACTT
CATTCAGTTCGCTGGTGCAGTTGCTCTCACCAATTGTCCTGGTGCCCCTGTCCTGAACGTATCCATTGGCCGT
GTGGACG
CTACTCGAGCAGCTCCTGACGGCCTCGTCCCTGAGCCTTTCGACGATGTTGACAAGATTCTCAACCGCTTCAACGACGCCGGGGAATTTGATGAGCTTGAGACGGTTTGGTTC
TTGATCGC
ACACTCTGTTGCCGCTCAGAATGATATTGATCCAACTATCCCGCGCACGCCATTTGATTCTACACCGTCGATCATGGATGGCCAATTCTTCATCGAGACACAATTGAAGGGC
CTCGGCTTCCCTGG
TGACGATCCTGGTGAAGGAGAGGCACTTAGTCCGCTCGCAGGGGAGTTCCGTCTCCAATCCGACTTCTTGCTTGCACGCGATAACAGGACGGCGTGTGAATGGCAG
TCTTTCGGAA
CGGACCAAGCCAAACTCCAGAACCGCTTCCAGTTCATCTTCCAGGCGATGGGCCAGCTCGGTCAGAACGTATCCAACTTGATCGATTGCAGCGATGTTCTCGCCATCCCG
CCGCCTCTGACTACCACTCCCCACCTCCCTGCTGGCAAGACTTTGGACGATGTTCAGCCCGCT
TGTGCCGACACTCCTTTCCCTTCTCTCACCGCGGACCCCGGCCCCGCCACCCGGGTC
GCCACTGT
TCCGAGGGATTGA

Retrieve as FASTA