Entry information : PbreLiP02 (LiP2)
Entry ID 9700
Creation 2011-11-01 (Christophe Dunand)
Last sequence changes 2016-06-08 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-08 (Catherine Mathe)
Peroxidase information: PbreLiP02 (LiP2)
Name (synonym) PbreLiP02 (LiP2)
Class Lignin peroxidase    [Orthogroup: LiP005]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreLiP02
start..stop
S start..stop
PbreLiP03 553 0 1..358 1..362
PrLiP03 539 0 1..359 1..359
PrLiP04 516 0 1..359 1..359
PrLiP01 504 1e-180 1..366 1..370
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1049616..1049667 52 N° 2 1049723..1049927 205 N° 3 1049981..1050115 135 N° 4 1050169..1050236 68
N° 5 1050289..1050300 12 N° 6 1050351..1050392 42 N° 7 1050459..1050537 79 N° 8 1050597..1050722 126
N° 9 1050777..1050846 70 N° 10 1050899..1050944 46 N° 11 1051007..1051179 173 N° 12 1051232..1051299 68
N° 13 1051350..1051374 25  
join(1049616..1049667,1049723..1049927,1049981..1050115,1050169..1050236,1050289 ..1050300,1050351..1050392,1050459..1050537,1050597..1050722,1050777..1050846,10 50899..1050944,1051007..1051179,1051232..1051299,1051350..1051374)


exon

Literature and cross-references PbreLiP02 (LiP2)
DNA ref. JGI genome:   scaffold_12 (1049616..1051374)
Protein sequence: PbreLiP02 (LiP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (348)
PWM (Da):   %s   38537.79 (36645.8)  
PI (pH):   %s   3.95 (3.91) Peptide Signal:   %s   cut: 19 range:19-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLFTAVSLALAASAAITRRVACPDGVNTAMNAACCALFAVRDDLQNNLFQNECADEAHEALRLTFHDAIAFSPALQASGQFGGGGADGSIVIFADIETAFQANVGLDEVVAHQAPFLARSNMSVADFIQFAGAVGTSNCPGAPQLNAFIGRVDATQAAPDGLVPEPFDDVDTILARFADAGDFDELESTWFLIAHSVAAQKDIDPSVRAAPFDSTPSIMDGQFFIETQLRGIEFIGQGGIQGVAESPIEGEFRLQSDHDLARDERTACEWQSFGTDQAKLQNRFQFIFEAMGQLGTDPTTLTDCSDVLPTPPALTTTPHFPAGITIADVEQACNATAFPTLPTAPGPATAVPPVPAQPPLNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (13 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTTTTCACTGCCGTCTCCTTGGCCCTGGCAGCCAGTGGTATGCAATCTACCTATTCTCGATACACGCTGAGCCTCACGTGCCCATCACATAGCTGCTATCACCAG
GCGTGTTGCATGTCCCGATGGCGTCAACACCGCCATGAACGCTGCCTGCTGTGCTCTGTTCGCTGTTCGCGATGACTTGCAGAACAACCTCTTCCAGAACGAGTGCGCTGACGAGGCTCA
CGAGGCGCTGCGTCTCACTTTCCATGACGCCATCGCCTTCTCTCCCGCTTTGCAGGCCTCCGGCCAATTTGG
GTAGGCACTCTAGATTATACTTTGTATCGTGTAGTTGACCAACGCATG
CACAGTGGCGGCGGTGCCGACGGTTCCATCGTCATCTTCGCCGATATCGAGACTGCCTTCCAGGCTAATGTCGGTCTCGATGAGGTTGTGGCCCACCAGGCGCCATTCCTCGCCAGGAGC
AACATGAGTGTCGCTGACTT
GTACGTCATTACATCAGGAAGACTTATGCGCCGCCTCATTGAATGCCTTGCAGCATCCAATTCGCTGGCGCGGTCGGTACCTCGAACTGCCCCGGTGCTC
CTCAGCTCAACGCTTTCATCG
GTATGCCATTTTCCGATTACCGTATTTGACTATACTAACGATCGAAATACAGGCCGTGTAGATGGTAATTGCTGGACTGTCTATAATGATTTTCAAATA
CTTACCTTGTTTTAGCTACGCAAGCCGCACCCGATGGTCTCGTTCCTGAGCCTTTCGGTAGGAGTCCCTCCCATAACATATCCCCAACGAACGTTTCCTCACCAAAACCCTGATTTTTAA
TAGATGACGTCGACACGATCTTGGCTCGCTTCGCTGACGCCGGCGATTTCGACGAGCTCGAGAGTACTTGGTTCTTGATTGCGTGAGTGTTGATTTCGTGCTCATGCAACATAATGAGTG
CGACTTACAGAACCGACACAGCCACTCCGTTGCTGCCCAGAAGGATATCGATCCCTCTGTTCGCGCCGCGCCCTTCGACTCCACCCCCTCAATCATGGATGGCCAATTCTTCATCGAGAC
TCAGCTCCGTGGCATTGAGTTCATTGG
GTAGGCGAACATGTCCCTGACTTTAATTGTTATATTGACGTTTCAATTTTACAGCCAGGGCGGTATTCAGGGTGTAGCTGAGTCCCCCATCGA
GGGCGAGTTCCGTCTCCAGTCCGATCATGAT
GTACGTTTTTGCCTGTGCGACCTCTAGGACTGACCCTAAGTTCTCCTCATAGCTTGCCCGTGACGAGCGCACTGCTTGCGAATGGCAGT
CCTTCGGCA
GTGAGCCTCTACCCATTATTTCGTTCTAATTTCCATAACATAAAGCCACTCTTCTTCCACAGCCGATCAGGCCAAGCTCCAGAACCGCTTCCAGTTCATCTTCGAGGCTAT
GGGCCAGCTTGGCACTGACCCGACCACCTTGACCGACTGCTCTGACGTTCTTCCCACCCCGCCGGCCCTTACTACCACCCCTCACTTCCCGGCCGGTATAACCATCGCAGATGTTGAGCA
GGCT
GTAAGTCCCATACTTGATATCCCCTTAACTCGGTCACTAAGAGTCCCTGAAGTGCAACGCCACCGCCTTCCCGACCCTCCCGACTGCCCCTGGTCCCGCCACTGCTGTCCCCCCTG
TTCC
GTAAGTCTCACAGTGTCTCGCCATTCACGGTCCTCATTGTTTGTCTATAGGGCTCAGCCCCCTCTCAACGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTTTTCACTGCCGTCTCCTTGGCCCTGGCAGCCAGTGCTGCTATCACCAGGCGTGTTGCATGTCCCGATGGCGTCAACACCGCCATGAACGCTGCCTGCTGTGCT
CTGTTCGCTGTTCGCGATGACTTGCAGAACAACCTCTTCCAGAACGAGTGCGCTGACGAGGCTCACGAGGCGCTGCGTCTCACTTTCCATGACGCCATCGCCTTCTCTCCCGCTTTGCAG
GCCTCCGGCCAATTTGG
TGGCGGCGGTGCCGACGGTTCCATCGTCATCTTCGCCGATATCGAGACTGCCTTCCAGGCTAATGTCGGTCTCGATGAGGTTGTGGCCCACCAGGCGCCATTC
CTCGCCAGGAGCAACATGAGTGTCGCTGACTT
CATCCAATTCGCTGGCGCGGTCGGTACCTCGAACTGCCCCGGTGCTCCTCAGCTCAACGCTTTCATCGGCCGTGTAGATGCTACGCAA
GCCGCACCCGATGGTCTCGTTCCTGAGCCTTTCG
ATGACGTCGACACGATCTTGGCTCGCTTCGCTGACGCCGGCGATTTCGACGAGCTCGAGAGTACTTGGTTCTTGATTGCCCACTCC
GTTGCTGCCCAGAAGGATATCGATCCCTCTGTTCGCGCCGCGCCCTTCGACTCCACCCCCTCAATCATGGATGGCCAATTCTTCATCGAGACTCAGCTCCGTGGCATTGAGTTCATTGG
C
CAGGGCGGTATTCAGGGTGTAGCTGAGTCCCCCATCGAGGGCGAGTTCCGTCTCCAGTCCGATCATGAT
CTTGCCCGTGACGAGCGCACTGCTTGCGAATGGCAGTCCTTCGGCACCGAT
CAGGCCAAGCTCCAGAACCGCTTCCAGTTCATCTTCGAGGCTATGGGCCAGCTTGGCACTGACCCGACCACCTTGACCGACTGCTCTGACGTTCTTCCCACCCCGCCGGCCCTTACTACC
ACCCCTCACTTCCCGGCCGGTATAACCATCGCAGATGTTGAGCAGGCT
TGCAACGCCACCGCCTTCCCGACCCTCCCGACTGCCCCTGGTCCCGCCACTGCTGTCCCCCCTGTTCCGGCT
CAGCCCCCTCTCAACGCGTGA

Retrieve as FASTA