Entry information : BaLiP04
Entry ID 9726
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2012-03-27 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-11-20 (Christophe Dunand)
Peroxidase information: BaLiP04
Name BaLiP04
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP04
start..stop
S start..stop
BaLiP12 643 0 1..362 1..362
BaLiP03 642 0 1..362 1..362
BaLiP05 641 0 1..362 1..362
BaLiP03_IFO5307 639 0 1..362 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 134612..134814 203 N° 2 134867..134923 57 N° 3 134975..135189 215 N° 4 135242..135786 545
N° 5 135841..135909 69  
join(134612..134814,134867..134923,134975..135189,135242..135786,135841..135909)


exon

Literature and cross-references BaLiP04
DNA ref. JGI genome:   scaffold_29 (134612..135909)
Protein sequence: BaLiP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (344)
PWM (Da):   %s   38778.36 (36936.3)  
PI (pH):   %s   5.36 (5.19) Peptide Signal:   %s   cut: 19 range:19-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLLATLTAALVAQAAITKRVACPDGKHTATNAACCNLFTVRDDIQKNMFDGGKCNDVAHEALRLTFHDAVAISPAMQAKGKFGGNGADGSIMTFDKIETAFHPNIGLDEIVNIEKPFVQKHNMTPGDFIHFAGAIAVTNCPGAPTISFALGRPATRAAPDGLVPEPFHTADQIFARMNDAMEFDELETVWALIAHTVAAANDVDPSIPRTPFDSTPDLFDGQFFIDTQLRGTAFPGRGGLQGEVLSPLKGEMRLQSDHVIARDSRSACEWQSFATDHDKLTNRFQFVLETLANLGQDASKMIDCSEVIPIPKNLTPAQLTPMFPAGKTIKDVEQCADTPFPTLKTRPGAATAVPPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Last short exon is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCCTCGCTACGCTCACCGCTGCCCTCGTGGCGCAGGCCGCTATCACCAAGCGTGTCGCTTGTCCCGATGGCAAGCACACCGCGACCAATGCGGCCTGCTGCAAC
TTGTTCACCGTCCGAGACGACATTCAGAAGAACATGTTCGACGGCGGCAAGTGCAACGACGTTGCCCACGAAGCTCTGCGTCT
GTGAGTTCGATTGCACAATTATTAGCCAGGCCTTCGC
TCACTACCTGTCTAGGACGTTCCACGACGCCGTCGCCATTTCTCCTGCTATGCAGGCGAAGGGCAAATTCGGGTGCGTGTCTTGAACAATCTACTGCCAACAAAATTCTGACCGGAGCGA
TAGTGGAAACGGTGCTGACGGGTCTATCATGACGTTCGACAAGATCGAGACGGCCTTCCATCCGAACATTGGTCTTGACGAAATCGTCAACATCGAGAAGCCATTCGTACAGAAGCACAA
CATGACCCCCGGTGACTTCATTCACTTTGCGGGCGCCATTGCAGTGACCAATTGTCCGGGTGCACCCACCATCAGCTTCGCGCTTGGTCGTCCAGTCG
GTGAGTCTCGTGCGCAATCATG
CATACCGTAACCATGCTCAGTCTTTGTCAGCTACTCGGGCCGCTCCTGACGGGCTTGTTCCCGAGCCATTTCACACTGCCGACCAGATCTTCGCTCGCATGAACGATGCCATGGAATTCG
ACGAGCTTGAGACCGTCTGGGCTCTCATTGCCCACACCGTCGCTGCGGCTAACGACGTCGACCCGTCCATCCCGCGCACGCCCTTCGACTCGACTCCTGACTTGTTCGACGGCCAGTTCT
TCATCGACACCCAGCTCCGGGGCACTGCGTTCCCCGGCAGAGGCGGTCTGCAGGGCGAGGTCCTGTCTCCGCTCAAGGGTGAAATGCGTCTCCAGTCCGACCATGTCATCGCTCGCGACT
CCCGCTCAGCCTGCGAGTGGCAGTCGTTCGCCACGGACCACGACAAGCTTACCAACCGCTTCCAGTTCGTGCTGGAGACGCTCGCAAACCTCGGCCAGGATGCCTCCAAGATGATCGACT
GCTCTGAAGTTATTCCGATCCCCAAGAATCTTACTCCAGCTCAACTCACCCCCATGTTCCCTGCGGGAAAGACTATTAAGGACGTCGAACAGGCT
GTAAGTACTATGCGGCTACTTCAGC
TCAGACGAAGCATCTAACGCTTCTCACAGTGCGCGGACACTCCCTTCCCCACGCTCAAGACGAGGCCTGGTGCAGCCACTGCAGTCCCTCCCGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCCTCGCTACGCTCACCGCTGCCCTCGTGGCGCAGGCCGCTATCACCAAGCGTGTCGCTTGTCCCGATGGCAAGCACACCGCGACCAATGCGGCCTGCTGCAAC
TTGTTCACCGTCCGAGACGACATTCAGAAGAACATGTTCGACGGCGGCAAGTGCAACGACGTTGCCCACGAAGCTCTGCGTCT
GACGTTCCACGACGCCGTCGCCATTTCTCCTGCTATG
CAGGCGAAGGGCAAATTCGG
TGGAAACGGTGCTGACGGGTCTATCATGACGTTCGACAAGATCGAGACGGCCTTCCATCCGAACATTGGTCTTGACGAAATCGTCAACATCGAGAAGCCA
TTCGTACAGAAGCACAACATGACCCCCGGTGACTTCATTCACTTTGCGGGCGCCATTGCAGTGACCAATTGTCCGGGTGCACCCACCATCAGCTTCGCGCTTGGTCGTCCAGTCG
CTACT
CGGGCCGCTCCTGACGGGCTTGTTCCCGAGCCATTTCACACTGCCGACCAGATCTTCGCTCGCATGAACGATGCCATGGAATTCGACGAGCTTGAGACCGTCTGGGCTCTCATTGCCCAC
ACCGTCGCTGCGGCTAACGACGTCGACCCGTCCATCCCGCGCACGCCCTTCGACTCGACTCCTGACTTGTTCGACGGCCAGTTCTTCATCGACACCCAGCTCCGGGGCACTGCGTTCCCC
GGCAGAGGCGGTCTGCAGGGCGAGGTCCTGTCTCCGCTCAAGGGTGAAATGCGTCTCCAGTCCGACCATGTCATCGCTCGCGACTCCCGCTCAGCCTGCGAGTGGCAGTCGTTCGCCACG
GACCACGACAAGCTTACCAACCGCTTCCAGTTCGTGCTGGAGACGCTCGCAAACCTCGGCCAGGATGCCTCCAAGATGATCGACTGCTCTGAAGTTATTCCGATCCCCAAGAATCTTACT
CCAGCTCAACTCACCCCCATGTTCCCTGCGGGAAAGACTATTAAGGACGTCGAACAGGCT
TGCGCGGACACTCCCTTCCCCACGCTCAAGACGAGGCCTGGTGCAGCCACTGCAGTCCCT
CCCGTGTAA

Retrieve as FASTA