Entry information : BaLiP05
Entry ID 9727
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Christophe Dunand)
Peroxidase information: BaLiP05
Name BaLiP05
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP05
start..stop
S start..stop
BaLiP06 753 0 1..372 1..372
BaLiP03 672 0 1..372 1..372
BaLiP03_IFO5307 671 0 1..372 1..372
BaLiP07 645 0 1..372 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 77034..77236 203 N° 2 77290..77346 57 N° 3 77399..77613 215 N° 4 77670..78214 545
N° 5 78269..78333 65 N° 6 78390..78423 34  
join(77034..77236,77290..77346,77399..77613,77670..78214,78269..78333,78390..784 23)


exon

Literature and cross-references BaLiP05
DNA ref. JGI genome:   scaffold_19 (77034..78423)
Protein sequence: BaLiP05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (354)
PWM (Da):   %s   39737.75 (37870.7)  
PI (pH):   %s   4.72 (4.60) Peptide Signal:   %s   cut: 19 range:19-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKHLLTTLSAALVAQAALTKRVACPDGKHTAINAACCNLFTVRDDIQKNMFEGGKCNDVAHEALRLTFHDAVAFSPSMEAKGQFGGNGADGSIMTFDTIETNFHPNIGLDEIVNIEKPFAKFHNMTPGDFIHFAGAIAVTNCPGAPTLSFLLGRPPVAAAPDNLVPEPFHTATQIFDRMNDALEFDELETVWGLIAHTIGASNDVDASIPRTPFDSTPDLFDGQFFIDTQLRGILFPGKGGLQGEVESPLKGEIRLQSDHVIARDSRSACEWQSFGTDHDKLTNRFQFVVETLAMVGQDPTNMIDCSEVIPIPKDLTPEQLAPKLPAGKTMNDVEQCADTPFPSLKAAPGPATAVAPVPKVKTGAPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCACCTTTTGACAACCCTCTCCGCCGCCCTTGTGGCACAAGCCGCACTCACCAAGCGCGTCGCTTGCCCTGACGGCAAGCACACTGCTATCAACGCGGCGTGCTGCAAC
CTGTTCACCGTCCGCGACGACATCCAGAAGAACATGTTCGAGGGTGGCAAATGCAACGACGTTGCCCACGAGGCTCTTCGTCT
GTGAGTACTGATGGCGGTGGCCGCCTAGATATAGCTT
ACTGAACGCATCGCAGGACCTTTCACGACGCTGTCGCGTTTTCGCCCAGCATGGAGGCCAAGGGCCAGTTCGGGTCAGTCATTCTAATATTCTCTACGATAAAATCGGTCTGACACGAGT
CACAGTGGTAACGGTGCCGACGGGTCTATTATGACCTTCGACACCATCGAGACCAACTTCCACCCCAACATCGGTCTTGACGAGATTGTCAACATTGAGAAGCCGTTCGCTAAGTTCCAC
AACATGACCCCCGGTGACTTCATCCACTTTGCGGGCGCCATCGCCGTCACGAACTGCCCCGGCGCGCCCACTCTCAGCTTCTTGCTCGGCCGCCCCCCAC
GTATGCCACCCATTCTATTC
CTCGACTCACCTAACACACTGATTTCTCCTTCGTAGCGGTCGCTGCTGCTCCCGACAATCTCGTTCCCGAGCCGTTCCACACGGCGACGCAGATCTTCGACCGCATGAACGACGCGCTCG
AGTTCGACGAGCTCGAGACCGTGTGGGGCCTCATCGCCCACACCATCGGTGCCTCCAACGACGTCGACGCGTCCATCCCGCGCACACCCTTCGACTCGACCCCGGATCTCTTCGACGGCC
AATTCTTCATCGACACTCAGCTCCGCGGCATCCTGTTCCCCGGCAAGGGCGGTCTCCAGGGTGAAGTCGAGTCTCCGCTCAAGGGTGAAATCCGTCTCCAGTCCGACCACGTCATCGCGC
GCGACTCTCGCTCTGCTTGCGAGTGGCAATCGTTTGGCACCGACCACGACAAGCTTACCAACCGATTCCAGTTCGTCGTCGAGACCCTCGCGATGGTTGGCCAGGACCCGACGAACATGA
TCGACTGCTCCGAGGTCATCCCCATCCCCAAGGACCTGACTCCCGAGCAGCTCGCACCCAAGCTCCCCGCTGGCAAGACCATGAACGACGTCGAGCAGGCT
GTACGTCGATCTCACCCTC
TCACGTTAATCACATTCCTGACCTGTATTTCACAGTGCGCCGACACCCCCTTCCCCTCACTCAAGGCTGCCCCCGGACCGGCCACCGCTGTGGCTCCTGTGTACGCACCTTACAATATTT
CAAGCTGTCGCACTCTCTGATGATCTCCTTCTACAGCCCGAAGGTCAAGACCGGTGCTCCGGGATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCACCTTTTGACAACCCTCTCCGCCGCCCTTGTGGCACAAGCCGCACTCACCAAGCGCGTCGCTTGCCCTGACGGCAAGCACACTGCTATCAACGCGGCGTGCTGCAAC
CTGTTCACCGTCCGCGACGACATCCAGAAGAACATGTTCGAGGGTGGCAAATGCAACGACGTTGCCCACGAGGCTCTTCGTCT
GACCTTTCACGACGCTGTCGCGTTTTCGCCCAGCATG
GAGGCCAAGGGCCAGTTCGG
TGGTAACGGTGCCGACGGGTCTATTATGACCTTCGACACCATCGAGACCAACTTCCACCCCAACATCGGTCTTGACGAGATTGTCAACATTGAGAAGCCG
TTCGCTAAGTTCCACAACATGACCCCCGGTGACTTCATCCACTTTGCGGGCGCCATCGCCGTCACGAACTGCCCCGGCGCGCCCACTCTCAGCTTCTTGCTCGGCCGCCCCCCAC
CGGTC
GCTGCTGCTCCCGACAATCTCGTTCCCGAGCCGTTCCACACGGCGACGCAGATCTTCGACCGCATGAACGACGCGCTCGAGTTCGACGAGCTCGAGACCGTGTGGGGCCTCATCGCCCAC
ACCATCGGTGCCTCCAACGACGTCGACGCGTCCATCCCGCGCACACCCTTCGACTCGACCCCGGATCTCTTCGACGGCCAATTCTTCATCGACACTCAGCTCCGCGGCATCCTGTTCCCC
GGCAAGGGCGGTCTCCAGGGTGAAGTCGAGTCTCCGCTCAAGGGTGAAATCCGTCTCCAGTCCGACCACGTCATCGCGCGCGACTCTCGCTCTGCTTGCGAGTGGCAATCGTTTGGCACC
GACCACGACAAGCTTACCAACCGATTCCAGTTCGTCGTCGAGACCCTCGCGATGGTTGGCCAGGACCCGACGAACATGATCGACTGCTCCGAGGTCATCCCCATCCCCAAGGACCTGACT
CCCGAGCAGCTCGCACCCAAGCTCCCCGCTGGCAAGACCATGAACGACGTCGAGCAGGCT
TGCGCCGACACCCCCTTCCCCTCACTCAAGGCTGCCCCCGGACCGGCCACCGCTGTGGCT
CCTGT
CCCGAAGGTCAAGACCGGTGCTCCGGGATCTTAA

Retrieve as FASTA