Entry information : BaLiP06
Entry ID 9729
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Christophe Dunand)
Peroxidase information: BaLiP06
Name BaLiP06
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP06
start..stop
S start..stop
BaLiP05 753 0 1..372 1..372
BaLiP03 673 0 1..372 1..372
BaLiP03_IFO5307 672 0 1..372 1..372
BaLiP07 647 0 1..372 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 629716..629918 203 N° 2 629972..630028 57 N° 3 630083..630297 215 N° 4 630359..630903 545
N° 5 630955..631019 65 N° 6 631076..631109 34  
join(629716..629918,629972..630028,630083..630297,630359..630903,630955..631019, 631076..631109)


exon

Literature and cross-references BaLiP06
DNA ref. JGI genome:   scaffold_19 (629716..631109)
Protein sequence: BaLiP06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (354)
PWM (Da):   %s   39692.71 (37875.7)  
PI (pH):   %s   4.6 (4.54) Peptide Signal:   %s   cut: 19 range:19-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLLTTLSAALVASAALTKRVACPDGRNTAINAACCNLFTVRDDIQKNMFEGGKCNDVAHEALRLTFHDAVAFSPSMEAKGQFGGNGADGSIMTFDTIETNFHPNIGLDEIVNIEKPFAKFHNMTPGDFIHFAGAIAVTNCPGAPTLSFLLGRPPVAAAPDNLVPEPFHTATQIFDRMNDALEFDELETVWGLIAHTIGASNDVDASIPRTPFDSTPDLFDGQFFIDTQLRGILFPGKGGLQGEVESPLKGEIRLQSDHVIARDSRSACEWQSFGTDHDKLTNRFQFVVETLAMVGQDPTNMIDCSEVIPIPKDLTPEQLAPKLPAGKTMNDVEQCADTPFPSLKAAPGPATAVAPVPKVKTGAPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCTTGACAACTCTCTCCGCCGCCCTCGTGGCTTCGGCCGCGCTCACCAAGCGCGTCGCCTGTCCCGACGGCAGGAACACCGCGATCAACGCGGCGTGCTGCAAC
TTGTTCACCGTGCGCGATGATATCCAGAAGAATATGTTCGAGGGCGGCAAGTGCAACGATGTCGCCCATGAGGCTCTGCGTTT
GTGAGTGCTCGTGTTAGTGGCCGTTTGGGAACAGCTT
ACTGAGCGCGTCACAGGACCTTCCACGACGCTGTCGCGTTTTCGCCCAGCATGGAGGCCAAGGGCCAATTCGGGTGCGCGATTTCCAACAATTATCCACAATAAAATTGGGCTGACGTGA
ATTGCAGTGGTAACGGCGCGGACGGGTCCATCATGACCTTCGACACCATCGAGACCAACTTCCACCCGAACATCGGCCTCGACGAGATCGTCAACATCGAAAAGCCGTTCGCCAAGTTCC
ACAACATGACCCCGGGTGACTTTATCCACTTTGCGGGTGCCATCGCCGTGACGAACTGTCCTGGCGCGCCCACGCTCAGTTTCCTGCTCGGCCGTCCTCCAC
GTACGCCACCCATCCCTT
CCTATACTTGAACTCGCGCAACGTACTAATCTCTACCTCGCAGCGGTCGCTGCTGCGCCAGACAACCTCGTCCCCGAGCCGTTCCACACCGCGACGCAGATCTTCGACCGCATGAACGAC
GCGCTCGAGTTTGACGAGCTCGAGACCGTATGGGGTCTGATCGCACACACCATCGGCGCGTCCAACGACGTCGACGCGTCCATCCCGCGCACACCCTTCGACTCGACTCCCGACTTGTTC
GACGGCCAGTTCTTCATTGACACCCAACTCCGCGGCATCCTGTTCCCCGGCAAGGGCGGTCTCCAGGGCGAAGTCGAATCCCCGCTGAAGGGTGAAATCCGTCTGCAGTCCGACCACGTC
ATCGCGCGCGACTCTCGCTCTGCTTGCGAGTGGCAATCGTTCGGCACCGACCACGACAAGCTTACCAACCGGTTCCAGTTCGTTGTCGAGACCCTCGCGATGGTTGGCCAGGACCCGACG
AACATGATCGACTGCTCCGAAGTTATCCCCATCCCCAAGGACCTGACTCCCGAGCAGCTCGCACCCAAGCTCCCCGCTGGCAAGACCATGAACGACGTCGAGCAGGCT
GTACGTCGATCT
CAGCTCACGTTAATCACATTCCTGACATGTATTTCACAGTGCGCCGACACCCCCTTCCCCTCGCTCAAGGCTGCCCCCGGACCTGCCACCGCTGTGGCTCCTGTGTACGCACCTTACAAT
ATTTCAAGCTGTCACACTCTCTGACGATCTCCTTCTACAGCCCGAAGGTCAAGACAGGTGCTCCGGGATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCTTGACAACTCTCTCCGCCGCCCTCGTGGCTTCGGCCGCGCTCACCAAGCGCGTCGCCTGTCCCGACGGCAGGAACACCGCGATCAACGCGGCGTGCTGCAAC
TTGTTCACCGTGCGCGATGATATCCAGAAGAATATGTTCGAGGGCGGCAAGTGCAACGATGTCGCCCATGAGGCTCTGCGTTT
GACCTTCCACGACGCTGTCGCGTTTTCGCCCAGCATG
GAGGCCAAGGGCCAATTCGG
TGGTAACGGCGCGGACGGGTCCATCATGACCTTCGACACCATCGAGACCAACTTCCACCCGAACATCGGCCTCGACGAGATCGTCAACATCGAAAAGCCG
TTCGCCAAGTTCCACAACATGACCCCGGGTGACTTTATCCACTTTGCGGGTGCCATCGCCGTGACGAACTGTCCTGGCGCGCCCACGCTCAGTTTCCTGCTCGGCCGTCCTCCAC
CGGTC
GCTGCTGCGCCAGACAACCTCGTCCCCGAGCCGTTCCACACCGCGACGCAGATCTTCGACCGCATGAACGACGCGCTCGAGTTTGACGAGCTCGAGACCGTATGGGGTCTGATCGCACAC
ACCATCGGCGCGTCCAACGACGTCGACGCGTCCATCCCGCGCACACCCTTCGACTCGACTCCCGACTTGTTCGACGGCCAGTTCTTCATTGACACCCAACTCCGCGGCATCCTGTTCCCC
GGCAAGGGCGGTCTCCAGGGCGAAGTCGAATCCCCGCTGAAGGGTGAAATCCGTCTGCAGTCCGACCACGTCATCGCGCGCGACTCTCGCTCTGCTTGCGAGTGGCAATCGTTCGGCACC
GACCACGACAAGCTTACCAACCGGTTCCAGTTCGTTGTCGAGACCCTCGCGATGGTTGGCCAGGACCCGACGAACATGATCGACTGCTCCGAAGTTATCCCCATCCCCAAGGACCTGACT
CCCGAGCAGCTCGCACCCAAGCTCCCCGCTGGCAAGACCATGAACGACGTCGAGCAGGCT
TGCGCCGACACCCCCTTCCCCTCGCTCAAGGCTGCCCCCGGACCTGCCACCGCTGTGGCT
CCTGT
CCCGAAGGTCAAGACAGGTGCTCCGGGATCTTAA

Retrieve as FASTA