Entry information : BaLiP09
Entry ID 9733
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2012-03-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-17 (Christophe Dunand)
Peroxidase information: BaLiP09
Name BaLiP09
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP09
start..stop
S start..stop
BaLiP11 596 0 1..364 1..362
BaLiP04 593 0 1..364 1..362
BaLiP08 587 0 1..364 1..362
BaLiP05 578 0 1..364 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 336871..337082 212 N° 2 337132..337188 57 N° 3 337239..337373 135 N° 4 337426..337493 68
N° 5 337552..337563 12 N° 6 337612..337653 42 N° 7 337708..337786 79 N° 8 337838..337963 126
N° 9 338018..338133 116 N° 10 338187..338365 179 N° 11 338416..338484 69  
join(336871..337082,337132..337188,337239..337373,337426..337493,337552..337563, 337612..337653,337708..337786,337838..337963,338018..338133,338187..338365,33841 6..338484)


exon

Literature and cross-references BaLiP09
DNA ref. JGI genome:   scaffold_19 (336871..338484)
Protein sequence: BaLiP09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   39324.58 (37125.4)  
PI (pH):   %s   4.79 (4.65) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKHLATVLSVAFSLQAVQGAIIKRVACPDGRHTAINAACCNLFTVRDDIQRNMFDGGKCNDIAHQALRLTFHDAVAFSPALEAEGKFGGNGADGSIITFGNIETNFHPNIGLDEIVEIEKPFIARHNMTPGDFLHFAGAIAVTNCPGAPTISFSGRPVATRPAPDGLVPEPFHTPDQIFARMLDALEFDELETTWALIAHTVAAADDIDTSIPRSPFDSTPELFDGQFFIETQLKGTLFPGNGPNKGEVRSPLAGEMRLQSDFLIARDNRSACEWQSFTDHDKLTNRFQFVLETLAMVGQDPTNMIDCSEVIPIPRNLTSAQIPHFPAGKTIRDVEACPETPFPRLPTDAGRPTAVAPV*

Retrieve as FASTA  
Remarks complete sequence from genomic (11 introns) and ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCACCTCGCCACTGTGCTCTCTGTCGCCTTCTCTCTTCAGGCTGTCCAAGGCGCGATCATCAAACGCGTCGCCTGTCCCGACGGCAGGCACACCGCGATCAACGCTGCG
TGCTGCAACCTCTTCACGGTCCGCGACGACATCCAGAGGAACATGTTCGACGGTGGCAAATGTAACGACATAGCTCACCAGGCTCTCCGTCT
GTAAGTGCCAATAACTTCCTATGCAGCC
CTTTCTGACCACCGCCCGAAGCACTTTCCATGACGCCGTTGCTTTCTCGCCCGCCCTTGAGGCTGAGGGCAAATTTGGGTACGTTGCAGCGATATTTGCGATGATCTATCTCCTTACGGT
CATTGCAGTGGTAACGGCGCAGACGGCTCCATCATCACCTTCGGCAACATCGAGACCAACTTCCACCCCAACATCGGTCTCGACGAGATCGTCGAGATTGAGAAGCCGTTTATTGCCAGG
CACAACATGACCCCCGGAGACTT
GTTCGTATCCAGTATTCTTTCACGTGGGAAAATCCGTCTCATCACCCCTTAGCTTGCACTTCGCTGGTGCGATTGCTGTTACTAACTGCCCTGGTGC
CCCGACCATCAGCTTCTCCCTCG
GTAAGTCACATTTCCGTTTTGCCTCGATTTCTATATTCATCTAATGATATACTTCTAGGACGCCCTGTGGGTATGTAATGAGTTTTTCTCACACAAA
GACTGTGCTGAATTTTCCCAGCGACTCGTCCTGCGCCCGATGGCCTCGTTCCTGAGCCATTCCGTATGCAATTTTGTCCTGGCATCTCCGAGTTAAACCTGACCATACCAAAAATAGACA
CCCCCGACCAAATCTTTGCTCGCATGTTGGACGCCCTGGAATTTGACGAACTCGAGACGACTTGGGCCTTGATTGC
GTAAGCCTGACACACATTGATATCCTTTCATCTACCGACGATAT
TATCCAGGCACACCGTTGCTGCCGCCGACGATATTGACACGTCTATCCCTCGAAGCCCCTTCGACTCGACTCCGGAGCTGTTTGACGGACAGTTCTTCATCGAGACTCAGCTCAAGGGAA
CTTTGTTCCCAGG
GTAAGCATAGCATCTACCTCTGTTGCCGCGTCAGTAACCCAGCATATGTCACAGTAACGGCCCCAACAAGGGAGAGGTTCGCTCTCCTCTTGCCGGAGAGATGCGTC
TTCAGTCGGACTTCCTCATCGCTCGTGACAACCGTAGCGCTTGCGAGTGGCAATCCTTCGGCA
GTCAGTAATGTCTCTCTGCCCACCTGATTGTCACTGACTCGGATTTTTTTCAGCCGA
CCACGACAAACTTACCAACCGATTCCAGTTCGTCCTCGAGACTCTCGCTATGGTTGGCCAGGACCCCACGAACATGATCGACTGCTCCGAGGTCATCCCCATCCCACGCAACTTGACATC
CGCCCAGATTCCTCACTTCCCCGCTGGAAAGACTATTCGCGACGTTGAGGCTGCC
GTAAGTGGTCTATTGTTTTCGTCATCTCAGCTCAACTGACTCTGCTCCAGTGCCCCGAAACCCCC
TTCCCTCGCCTCCCCACCGATGCCGGCCGCCCCACAGCTGTCGCCCCTGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCACCTCGCCACTGTGCTCTCTGTCGCCTTCTCTCTTCAGGCTGTCCAAGGCGCGATCATCAAACGCGTCGCCTGTCCCGACGGCAGGCACACCGCGATCAACGCTGCG
TGCTGCAACCTCTTCACGGTCCGCGACGACATCCAGAGGAACATGTTCGACGGTGGCAAATGTAACGACATAGCTCACCAGGCTCTCCGTCT
CACTTTCCATGACGCCGTTGCTTTCTCG
CCCGCCCTTGAGGCTGAGGGCAAATTTGG
TGGTAACGGCGCAGACGGCTCCATCATCACCTTCGGCAACATCGAGACCAACTTCCACCCCAACATCGGTCTCGACGAGATCGTCGAGATT
GAGAAGCCGTTTATTGCCAGGCACAACATGACCCCCGGAGACTT
CTTGCACTTCGCTGGTGCGATTGCTGTTACTAACTGCCCTGGTGCCCCGACCATCAGCTTCTCCCTCGGACGCCCT
GTGG
CGACTCGTCCTGCGCCCGATGGCCTCGTTCCTGAGCCATTCCACACCCCCGACCAAATCTTTGCTCGCATGTTGGACGCCCTGGAATTTGACGAACTCGAGACGACTTGGGCCTTG
ATTGC
GCACACCGTTGCTGCCGCCGACGATATTGACACGTCTATCCCTCGAAGCCCCTTCGACTCGACTCCGGAGCTGTTTGACGGACAGTTCTTCATCGAGACTCAGCTCAAGGGAACT
TTGTTCCCAGG
TAACGGCCCCAACAAGGGAGAGGTTCGCTCTCCTCTTGCCGGAGAGATGCGTCTTCAGTCGGACTTCCTCATCGCTCGTGACAACCGTAGCGCTTGCGAGTGGCAATCC
TTCGGCA
CCGACCACGACAAACTTACCAACCGATTCCAGTTCGTCCTCGAGACTCTCGCTATGGTTGGCCAGGACCCCACGAACATGATCGACTGCTCCGAGGTCATCCCCATCCCACGC
AACTTGACATCCGCCCAGATTCCTCACTTCCCCGCTGGAAAGACTATTCGCGACGTTGAGGCTGCC
TGCCCCGAAACCCCCTTCCCTCGCCTCCCCACCGATGCCGGCCGCCCCACAGCT
GTCGCCCCTGTGTGA

Retrieve as FASTA