Entry information : BaLiP10
Entry ID 9735
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaLiP10
Name BaLiP10
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP10
start..stop
S start..stop
BaLiP05 498 4e-178 1..368 1..371
BaLiP06 484 8e-173 1..368 1..371
BaLiP03 483 2e-172 1..368 1..371
BaLiP03_IFO5307 483 3e-172 1..368 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40163..40371 209 N° 2 40067..40111 45 N° 3 39800..40014 215 N° 4 39201..39745 545
N° 5 39082..39143 62 N° 6 38998..39031 34  
complement(join(38998..39031,39082..39143,39201..39745,39800..40014,40067..40111 ,40163..40371))


exon

Literature and cross-references BaLiP10
DNA ref. JGI genome:   scaffold_29 (40371..38998)
Protein sequence: BaLiP10
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369 (348)
PWM (Da):   %s   39333.42 (37025.2)  
PI (pH):   %s   5.94 (5.54) Peptide Signal:   %s   cut: 22 range:22-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKHLLFLTTLALSFYTAQAALTKRVSCGHGRTVKNAQCCSLFNVLDDIQKNMFEGGKCNDVAHEALRLTFHDAVGHSNSNKASGGGADGSIMTFADVETKYPANVGLDEIVNIEAPFAKFHNMTPGDFIHFAGAVAVTNCPGAPSLSFSLGRPAKGPASDGLVPAPFDTLDKIFDRMQDALGFTPVETVWALAAHSIGSASDVDPSIPRTPFDSTPGIFDAQFFVETQLRGTLFPGKGGIQGEVESPMRGEIRLQSDHLMARDSRSSCEWQSFVTDHPKLQNRFQFAMETIAVVGQDTTNMVDCSEVIPQPPPLPPSHPVSMLPFGMSKNDIEQCASAMFPTLIPLGARGPIPPVPKARTNSPGH

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAAACACCTTCTTTTCTTGACAACTCTCGCTCTTTCCTTCTACACCGCCCAGGCCGCCCTTACGAAGCGGGTCTCCTGCGGTCACGGGCGCACTGTCAAAAATGCGCAGTGT
TGTTCTCTGTTCAACGTGCTCGACGATATTCAGAAGAATATGTTCGAGGGTGGAAAGTGCAACGATGTCGCCCACGAAGCGCTTCGATT
GTAAGTCTTCCTCCGAATATCGTTTCTTGAA
AATTCTCAATTTGCATGTAGGACGTTCCACGATGCTGTCGGTCACTCGAACTCCAACAAGGCTAGGTAATACACTCCTCCTTATTCAAGACGACAAGACTGACGGGCCTTTTTCCAGCGG
TGGTGGTGCGGACGGGTCTATCATGACCTTTGCAGACGTCGAGACCAAGTACCCCGCCAACGTCGGTCTCGACGAGATCGTCAACATCGAGGCACCATTCGCCAAGTTTCACAACATGAC
GCCTGGAGATTTCATCCACTTCGCGGGCGCCGTCGCGGTCACAAACTGTCCTGGCGCACCTTCGCTGAGCTTCTCTCTTGGCCGCCCGATAG
GCGAGTCAAGCAGCTGTGTTTATTATTC
GTCATTGTTTGACTGAAAATTTTCAGCCAAGGGCCCCGCATCGGATGGTCTCGTCCCCGCGCCATTCGACACCTTGGACAAGATATTCGACCGCATGCAGGATGCCTTGGGCTTTACCCC
GGTTGAGACCGTCTGGGCCCTCGCCGCACACTCCATCGGGTCTGCCAGTGACGTCGATCCTTCCATCCCGCGCACACCCTTCGACTCTACACCCGGTATCTTCGACGCGCAATTCTTCGT
GGAGACGCAGCTCCGCGGCACACTGTTCCCCGGCAAGGGCGGAATCCAGGGCGAGGTCGAGTCTCCAATGAGGGGGGAGATACGACTCCAATCCGACCACCTCATGGCGCGCGACTCGCG
TTCGTCGTGCGAGTGGCAGTCGTTTGTGACCGACCATCCCAAGCTCCAGAACCGGTTCCAGTTTGCCATGGAGACTATCGCCGTGGTGGGCCAGGACACGACGAACATGGTTGATTGCTC
GGAGGTCATTCCTCAGCCGCCCCCTCTTCCACCCTCCCACCCTGTTTCTATGTTACCTTTCGGGATGTCCAAAAATGATATTGAACAGGCT
GTGAGCACCCCCCTAATTCGTGCGATGGA
ATCACAGCAGCTGATGTGCGATTTGTAGTGCGCCAGTGCAATGTTCCCCACCCTCATCCCTCTAGGAGCCAGGGGTCCGATCCCTCCCGTGTAAGTGACCATCCTATCTGTCATCTATAT
ACTTGCTTACACTGTTATAGGCCCAAGGCACGCACTAATTCTCCGGGTCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAAACACCTTCTTTTCTTGACAACTCTCGCTCTTTCCTTCTACACCGCCCAGGCCGCCCTTACGAAGCGGGTCTCCTGCGGTCACGGGCGCACTGTCAAAAATGCGCAGTGT
TGTTCTCTGTTCAACGTGCTCGACGATATTCAGAAGAATATGTTCGAGGGTGGAAAGTGCAACGATGTCGCCCACGAAGCGCTTCGATT
GACGTTCCACGATGCTGTCGGTCACTCGAAC
TCCAACAAGGCTAG
CGGTGGTGGTGCGGACGGGTCTATCATGACCTTTGCAGACGTCGAGACCAAGTACCCCGCCAACGTCGGTCTCGACGAGATCGTCAACATCGAGGCACCATTCGCC
AAGTTTCACAACATGACGCCTGGAGATTTCATCCACTTCGCGGGCGCCGTCGCGGTCACAAACTGTCCTGGCGCACCTTCGCTGAGCTTCTCTCTTGGCCGCCCGATAG
CCAAGGGCCCC
GCATCGGATGGTCTCGTCCCCGCGCCATTCGACACCTTGGACAAGATATTCGACCGCATGCAGGATGCCTTGGGCTTTACCCCGGTTGAGACCGTCTGGGCCCTCGCCGCACACTCCATC
GGGTCTGCCAGTGACGTCGATCCTTCCATCCCGCGCACACCCTTCGACTCTACACCCGGTATCTTCGACGCGCAATTCTTCGTGGAGACGCAGCTCCGCGGCACACTGTTCCCCGGCAAG
GGCGGAATCCAGGGCGAGGTCGAGTCTCCAATGAGGGGGGAGATACGACTCCAATCCGACCACCTCATGGCGCGCGACTCGCGTTCGTCGTGCGAGTGGCAGTCGTTTGTGACCGACCAT
CCCAAGCTCCAGAACCGGTTCCAGTTTGCCATGGAGACTATCGCCGTGGTGGGCCAGGACACGACGAACATGGTTGATTGCTCGGAGGTCATTCCTCAGCCGCCCCCTCTTCCACCCTCC
CACCCTGTTTCTATGTTACCTTTCGGGATGTCCAAAAATGATATTGAACAGGCT
TGCGCCAGTGCAATGTTCCCCACCCTCATCCCTCTAGGAGCCAGGGGTCCGATCCCTCCCGTGCCC
AAGGCACGCACTAATTCTCCGGGTCATTAA

Retrieve as FASTA