Entry information : BaLiP11
Entry ID 9738
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaLiP11
Name BaLiP11
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP11
start..stop
S start..stop
BaLiP08 697 0 1..373 1..373
BaLiP09 596 0 1..362 1..364
BaLiP04 573 0 1..359 1..359
BaLiP05 553 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 305543..305754 212 N° 2 305429..305485 57 N° 3 305231..305365 135 N° 4 305109..305176 68
N° 5 305038..305049 12 N° 6 304948..304989 42 N° 7 304814..304892 79 N° 8 304633..304758 126
N° 9 304463..304578 116 N° 10 304233..304405 173 N° 11 304117..304181 65 N° 12 304018..304054 37
complement(join(304018..304054,304117..304181,304233..304405,304463..304578,3046 33..304758,304814..304892,304948..304989,305038..305049,305109..305176,305231..3 05365,305429..305485,305543..305754))


exon

Literature and cross-references BaLiP11
DNA ref. JGI genome:   scaffold_19 (305754..304018)
Protein sequence: BaLiP11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373 (352)
PWM (Da):   %s   40019.08 (37875.9)  
PI (pH):   %s   5.54 (5.36) Peptide Signal:   %s   cut: 22 range:22-373
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLVSALTLALSLTVAQGAIVKRVTCPGGRHTATNAACCKLFDVRDDIQRNMFEGGQCNDVAHEALRLTFHDAVAISPALEAKGKFGGNGADGSIITFGNIETKFHPNIGLDEIVAIEKPFIAKHNMTAGDFLHFAGAIAVTNCPGAPTISFSGRPPAVRAAPDGLVPEPFHTVDQIFDRMNDAMEFDPLETVWALIAHTVAAANDIDTAIPGSPFDSTPSDFDGQFFLETQLKGVLNPGRGLHQGEVLSPLFGEMRLQSDFAIARDSRSACEWQSFDDHDKLTNRFQFVLETFAMLGQDPTNMIDCSEVIPVPAALRTKPHFPAGKTIRDVEPCAETPFPTVPTDRGSPTVVARVPKSAVRRAHGF

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCGTTTCCGCGCTCACTCTTGCCCTTTCGCTCACCGTCGCACAAGGCGCGATTGTCAAACGCGTTACGTGCCCTGGCGGTCGCCACACAGCGACTAACGCGGCG
TGCTGCAAGCTGTTCGATGTCCGTGATGACATTCAAAGGAACATGTTCGAGGGCGGACAGTGCAACGATGTTGCTCACGAGGCGCTTCGTCT
GTAAGCCTTTTGGTGGCACCTAACGATC
TTTTTTGGTCTGTTCAACATCTCTCGCAGGACCTTCCATGACGCCGTGGCAATTTCCCCTGCCCTCGAGGCGAAGGGCAAGTTTGGGTACGCCTCATAAACCTCTGTTACAGTCACGCAA
TTGCTGAGCGTTTCATGTTCATTTCACAGTGGTAACGGAGCTGACGGCTCTATCATCACCTTCGGCAACATCGAGACCAAGTTTCACCCTAACATTGGTCTCGATGAAATTGTCGCCATC
GAGAAGCCGTTCATCGCGAAGCACAACATGACTGCTGGCGATTT
GTACGTATATTTCACCGTGTTTTTTTCCTCCTCCTTTGACTGATCTCCATCTAGCCTCCACTTCGCCGGTGCTATT
GCTGTGACCAACTGCCCAGGTGCTCCCACCATCAGCTTCTCCCTTG
GTAAGTTCCGTGTCGGTATATTCCTCCCACACAGACTATATTGACGACGTTCTCCTTAGGTCGTCCCCCAGGTT
AGTACAAATTACATGTATGAAATGTGCAATTCTGATCCTTTCTAGCGGTTCGCGCTGCTCCCGATGGCCTTGTTCCTGAACCGTTCCGTGAGTCAAGCTTAGTAAAACCCATGATACAAT
CTTCTGATGAAGTGTGCTACAGACACCGTCGACCAAATCTTCGATCGCATGAACGATGCTATGGAATTTGACCCACTCGAAACCGTCTGGGCTCTCATCGCGTGAGTCCTTGATACTCCT
AACATATCGATCGTATGGAAACTAACGGTACCATAGCCATACCGTGGCAGCTGCCAACGATATCGACACAGCCATCCCCGGTTCTCCATTCGACTCGACCCCAAGCGACTTTGATGGTCA
GTTCTTCCTGGAGACTCAACTCAAGGGCGTCCTGAACCCCGG
GTGAGTCGATATTTTTGGGATAAGGCACTTTAACAAATTCTAATGGTACTCTAGTCGCGGACTCCACCAGGGCGAAGT
ACTCTCCCCGCTCTTCGGCGAGATGCGCCTGCAATCCGACTTCGCTATTGCCCGTGACTCGCGCAGCGCATGTGAATGGCAGTCCTTCATCG
GCAAGTTTGCTTATTGACTGCACTGTTA
ATTCCATTCTCACAGCTTTTATCGTACAGACGATCACGACAAGCTCACCAACCGCTTCCAGTTTGTCCTCGAGACGTTCGCGATGCTTGGTCAGGATCCCACCAACATGATTGACTGCTC
TGAGGTCATCCCCGTCCCCGCGGCCCTTCGCACCAAGCCCCACTTCCCCGCTGGCAAGACCATCCGTGATGTCGAACCTGCT
GTACGTGTCTGTTGCTTTATAGCTGATAATTGAACTAA
CTTCATCGCTCAGTGCGCCGAGACTCCGTTCCCTACTGTCCCCACCGACCGCGGCTCCCCCACCGTCGTCGCTCGTGTGTACGTTTTCTTCTCCATCAGCTCTGACGTGGACGCAGAACC
TAACTCCGCATCTCCTATAGCCCCAAGAGCGCTGTCCGCCGCGCTCACGGTTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCGTTTCCGCGCTCACTCTTGCCCTTTCGCTCACCGTCGCACAAGGCGCGATTGTCAAACGCGTTACGTGCCCTGGCGGTCGCCACACAGCGACTAACGCGGCG
TGCTGCAAGCTGTTCGATGTCCGTGATGACATTCAAAGGAACATGTTCGAGGGCGGACAGTGCAACGATGTTGCTCACGAGGCGCTTCGTCT
GACCTTCCATGACGCCGTGGCAATTTCC
CCTGCCCTCGAGGCGAAGGGCAAGTTTGG
TGGTAACGGAGCTGACGGCTCTATCATCACCTTCGGCAACATCGAGACCAAGTTTCACCCTAACATTGGTCTCGATGAAATTGTCGCCATC
GAGAAGCCGTTCATCGCGAAGCACAACATGACTGCTGGCGATTT
CCTCCACTTCGCCGGTGCTATTGCTGTGACCAACTGCCCAGGTGCTCCCACCATCAGCTTCTCCCTTGGTCGTCCC
CCAG
CGGTTCGCGCTGCTCCCGATGGCCTTGTTCCTGAACCGTTCCACACCGTCGACCAAATCTTCGATCGCATGAACGATGCTATGGAATTTGACCCACTCGAAACCGTCTGGGCTCTC
ATCGC
CCATACCGTGGCAGCTGCCAACGATATCGACACAGCCATCCCCGGTTCTCCATTCGACTCGACCCCAAGCGACTTTGATGGTCAGTTCTTCCTGGAGACTCAACTCAAGGGCGTC
CTGAACCCCGG
TCGCGGACTCCACCAGGGCGAAGTACTCTCCCCGCTCTTCGGCGAGATGCGCCTGCAATCCGACTTCGCTATTGCCCGTGACTCGCGCAGCGCATGTGAATGGCAGTCC
TTCATCG
ACGATCACGACAAGCTCACCAACCGCTTCCAGTTTGTCCTCGAGACGTTCGCGATGCTTGGTCAGGATCCCACCAACATGATTGACTGCTCTGAGGTCATCCCCGTCCCCGCG
GCCCTTCGCACCAAGCCCCACTTCCCCGCTGGCAAGACCATCCGTGATGTCGAACCTGCT
TGCGCCGAGACTCCGTTCCCTACTGTCCCCACCGACCGCGGCTCCCCCACCGTCGTCGCT
CGTGT
CCCCAAGAGCGCTGTCCGCCGCGCTCACGGTTTCTAA

Retrieve as FASTA