Entry information : GluxMnP01
Entry ID 9745
Creation 2011-11-18 (Christophe Dunand)
Last sequence changes 2011-11-18 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: GluxMnP01
Name GluxMnP01
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxMnP01
start..stop
S start..stop
GluxMnP03 603 0 1..373 1..380
GluxMnP02 576 0 1..373 1..377
PstrMnP06 496 4e-177 1..373 1..369
PbreMnP04 495 1e-176 1..373 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 258671..258799 129 N° 2 258571..258622 52 N° 3 258494..258520 27 N° 4 258216..258439 224
N° 5 257932..258153 222 N° 6 257828..257882 55 N° 7 257756..257773 18 N° 8 257570..257698 129
N° 9 257383..257518 136 N° 10 257252..257325 74 N° 11 257143..257198 56  
complement(join(257143..257198,257252..257325,257383..257518,257570..257698,2577 56..257773,257828..257882,257932..258153,258216..258439,258494..258520,258571..2 58622,258671..258799))


exon

Literature and cross-references GluxMnP01
DNA ref. JGI genome:   scaffold_1 (258799..257143)
Protein sequence: GluxMnP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373 (355)
PWM (Da):   %s   38856.02 (36994.0)  
PI (pH):   %s   4.21 (4.21) Peptide Signal:   %s   cut: 19 range:19-373
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSFILPLLALASSVNSAPAASSATCSDGTVVSHSVCCDFIPLAKDLTENLFENECGETAHEVLRLSFHDAIAFSQSLGPSAGHGADGSMLIFPDVEPNYAANNGIADSVDDLAPFLASGKYPTISAGDMIQFGAAVAVGLCGSPQLEFLAGRPNATAPAIDGLIPEPQQSVTEILARFADAANLTAEDVVSLLASHSVGRADHVDPSVPAAPFDSTPFTFDSQFYLETLLVGTGFPGTANNTGEVPSPLPLGSGDNVGEIRLQSDFELARDSRTACFWQSMINQETLMAERFKAAMAKMAIIGQDKEKLVDCSAVVPKPLPALQKSAAYPATKSRKDVQQSCSSPFPSLTTPGSTETIIPHCPNGETDC

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns). Last exon?
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCTCGTTCATTCTACCACTACTTGCACTCGCATCTTCTGTAAACAGTGCACCTGCCGCTTCAAGTGCCACTTGCTCCGATGGTACCGTCGTCAGCCATTCTGTCTGTTGCGAT
TTTATTCCA
GTAAGGATCAAAACTTCTTTCTTGAATCCTTTGCTCAATGATAAATAGCTTGCCAAAGACTTGACTGAGAATCTTTTCGAGAATGAATGCGGAGAAACTGGTAGGTAGTAT
CGCTCAATCACATCTATTGAAGCTCATTGATCTCCAAAGCTCATGAAGTGCTACGTCTAAGCTTCCGTATGCGCCCGTCTCTTGGGTTGAAAATTTTTTACTAAATCCTTGATATAACAG

ACGACGCTATCGCGTTCTCTCAATCTTTAGGGCCATCAGCAGGCCATGGAGCAGACGGTAGCATGTTGATTTTCCCTGACGTGGAACCTAACTATGCAGCCAATAATGGCATAGCAGATA
GCGTCGACGACCTCGCTCCATTCCTAGCGTCTGGAAAGTACCCTACCATTTCTGCAGGCGATATGATCCAGTTCGGTGCTGCGGTAGCTGTTGGTCTTTGCCCT
GTGAGTTGAAGCGCTT
GCGTCCGTCGTCCTTTGTATTTTCACTAAGGTCACATTCTCCATAGGGATCCCCGCAACTAGAATTTCTTGCCGGTAGACCAAACGCGACAGCTCCAGCGATCGATGGACTGATCCCGGA
GCCTCAGCAATCGGTCACAGAAATTTTGGCCCGTTTTGCAGATGCTGCAAACTTGACAGCTGAAGATGTGGTCTCTCTCTTAGCCTCGCATTCGGTTGGCCGGGCAGATCATGTTGACCC
ATCTGTTCCAGCTGCGCCCTTTGACTCG
GTTAGGGTGGATTTTTTTGCCCGCTACTGCATTTACTAATCTCATGTAGACACCCTTTACGTTTGATAGCCAATTTTATCTCGAGACTCTTC
TCGTTGGCACAG
GTAAATGCTACGTCTATTTCTATTCAGTTGATCCTGATATGCGTGGCTTCGTAGGTTTCCCTGGAACAGCCAGTAAGAAATGTGAAATTAAAATTTCTCAGCGCTGCG
ACTGATAAACTTCACCTGAAGATAATACTGGAGAAGTTCCATCTCCTTTGCCTCTTGGAAGTGGGGACAACGTCGGAGAAATTCGTCTCCAATCCGATTTCGAGCTGGCCAGGGATAGCA
GAACAGCTTGTTTCTGGCAAAGCATGATCA
GTAAGAGTCGTTATTTGGACAATTAAATTCATCATATATTCAAGTAATCAGACCAGGAAACCCTAATGGCTGAACGATTCAAAGCTGCAA
TGGCAAAAATGGCGATTATTGGACAGGACAAAGAGAAACTAGTGGACTGCTCGGCGGTCGTACCAAAACCGCTCCCCGCCCTTCAGAAGTCTGCCGC
GTGAGAGCCCACCAGTTTTATTT
TTCTAGAATCAAGGTAGCTGAAGTCCATTCCCAGTTATCCCGCAACAAAATCTCGGAAGGATGTCCAACAGTCATGCTCGTCCCCATTCCCAAGTCTAACAACTAACCGTGAGTTACCCC
ATTGTCACAGACACGAAGTTTTCATTGATGGCATTATATAGCTGGTTCCACAGAGACAATCATTCCGCACTGTCCCAATGGAGAGACAGATTGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCTCGTTCATTCTACCACTACTTGCACTCGCATCTTCTGTAAACAGTGCACCTGCCGCTTCAAGTGCCACTTGCTCCGATGGTACCGTCGTCAGCCATTCTGTCTGTTGCGAT
TTTATTCCA
CTTGCCAAAGACTTGACTGAGAATCTTTTCGAGAATGAATGCGGAGAAACTGCTCATGAAGTGCTACGTCTAAGCTTCCACGACGCTATCGCGTTCTCTCAATCTTTAGGG
CCATCAGCAGGCCATGGAGCAGACGGTAGCATGTTGATTTTCCCTGACGTGGAACCTAACTATGCAGCCAATAATGGCATAGCAGATAGCGTCGACGACCTCGCTCCATTCCTAGCGTCT
GGAAAGTACCCTACCATTTCTGCAGGCGATATGATCCAGTTCGGTGCTGCGGTAGCTGTTGGTCTTTGCCCT
GGATCCCCGCAACTAGAATTTCTTGCCGGTAGACCAAACGCGACAGCT
CCAGCGATCGATGGACTGATCCCGGAGCCTCAGCAATCGGTCACAGAAATTTTGGCCCGTTTTGCAGATGCTGCAAACTTGACAGCTGAAGATGTGGTCTCTCTCTTAGCCTCGCATTCG
GTTGGCCGGGCAGATCATGTTGACCCATCTGTTCCAGCTGCGCCCTTTGACTCG
ACACCCTTTACGTTTGATAGCCAATTTTATCTCGAGACTCTTCTCGTTGGCACAGGTTTCCCTGGA
ACAGCCA
ATAATACTGGAGAAGTTCCATCTCCTTTGCCTCTTGGAAGTGGGGACAACGTCGGAGAAATTCGTCTCCAATCCGATTTCGAGCTGGCCAGGGATAGCAGAACAGCTTGTTTC
TGGCAAAGCATGATCA
ACCAGGAAACCCTAATGGCTGAACGATTCAAAGCTGCAATGGCAAAAATGGCGATTATTGGACAGGACAAAGAGAAACTAGTGGACTGCTCGGCGGTCGTACCA
AAACCGCTCCCCGCCCTTCAGAAGTCTGCCGC
TTATCCCGCAACAAAATCTCGGAAGGATGTCCAACAGTCATGCTCGTCCCCATTCCCAAGTCTAACAACTAACCCTGGTTCCACAGAG
ACAATCATTCCGCACTGTCCCAATGGAGAGACAGATTGTTAA

Retrieve as FASTA