Entry information : GluxMnP02
Entry ID 9748
Creation 2011-11-18 (Christophe Dunand)
Last sequence changes 2011-11-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxMnP02
Name GluxMnP02
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxMnP02
start..stop
S start..stop
GluxMnP03 603 0 9..377 12..380
GluxMnP01 576 0 1..377 1..373
PbreMnP07 493 7e-176 1..381 1..375
PbreMnP03 484 2e-172 1..381 1..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 125284..125415 132 N° 2 125165..125216 52 N° 3 125082..125108 27 N° 4 124987..125026 40
N° 5 124754..124937 184 N° 6 124576..124695 120 N° 7 124474..124515 42 N° 8 124288..124356 69
N° 9 124163..124235 73 N° 10 123981..124109 129 N° 11 123775..123910 136 N° 12 123639..123712 74
N° 13 123500..123576 77  
complement(join(123500..123576,123639..123712,123775..123910,123981..124109,1241 63..124235,124288..124356,124474..124515,124576..124695,124754..124937,124987..1 25026,125082..125108,125165..125216,125284..125415))


exon

Literature and cross-references GluxMnP02
DNA ref. JGI genome:   scaffold_95 (125415..123500)
Protein sequence: GluxMnP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (364)
PWM (Da):   %s   40141.75 (38057.7)  
PI (pH):   %s   4.23 (4.23) Peptide Signal:   %s   cut: 21 range:21-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSSTLLLFAAFAITLTNAAPSPHAVCSDGTVVSHASCCAFIPLAQDLTENLFENECGETAHEVLRLSFHDAIAFSQSKGRSAGGGADGSMLLFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCGAPQLEFLAGRPNATAPAIDGLIPEPQDSVDKILARFQDAANMNAEDIVSLLTSFVHPSVARADHVDPTLDAAPFDSTPFTFDSQFFLEVLLVGVGFPGLDNNTGELASPLPLTVGDNVGELRLQSDHAFAHDPRTACFWQEMINQEALMASRFKAAMAKMAIIGHNAEDLIDCSAVVPKPVPALKQATTFPATKSIRDVQQSCPLPFPSLSTPGALESEIPHCPDGQTSCDVVRSGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTTCATCGACACTACTGCTCTTCGCTGCGTTCGCTATTACTCTGACCAATGCAGCCCCGTCTCCTCATGCGGTCTGCTCTGACGGCACAGTCGTCAGTCATGCTTCGTGTTGC
GCCTTCATTCCC
GTAGGTTTTTTTTTTTTTGCCCTGTAATGATACGAGAAATGGTTAACCCACCACCTTTACCATCTAGTTGGCTCAAGATCTTACCGAGAATCTCTTTGAGAATGAGTG
CGGTGAAACTG
GTGGGTGCTTCCATTCTTTATGGCCTTTGAAGGAAATGCTGATGACTTTGTGATAGCTCACGAAGTCCTTCGTTTGAGCTTCCGTACGTTCTGTCTTGCCATGCTTGCC
CTTTCTCTTGAATGTAAATTCCATTACAGATGATGCAATTGCCTTTTCTCAATCTAAGGGACGCTCGGCGTAAGTGGTCGTATTGTAATCACCTCGCTCAAGTACTCATCGGTGACAGTG
GAGGAGGTGCAGATGGGAGCATGTTACTCTTCCCGGACGTCGAACCCAATTTTGCTGCCAATTTGGGAATTTCCGATAGCGTTAATGATCTCGCGCCCTTCCTCGCTTCTGGGAAGTTTC
CAACCATCACCGCGGGCGATATGATCCAGTTCGGAGCCGCCGTTGCTGTTGGGCTGTGTCCT
GTGCGTATTAAAGCATGCTTGTTTTCATCGTATCGTGATTCTGACGAGCTGACTCTAG

GGTGCACCCCAACTTGAATTCCTTGCTGGGCGTCCCAATGCTACTGCGCCTGCGATTGATGGATTGATTCCCGAGCCACAAGATTCGGTCGACAAAATCCTTGCTCGTTTCCAGGATGCT
GTATGTCTTTTTTCGTTCTTACTGATCAGCGAACGTAATTGATACCATTTGTGTCTTCAGGCCAATATGAATGCCGAGGATATCGTTTCTTTGCTTACATCGGTAAGTGATCGTCAACCA
GTTCCCTTGACTGACAGTATTGAATGACGACGTCGCAATTTTTTCTAGCACACAGGTACGATCATCATTTCGGAATACCATTGAAATTGTCTAAAAAAGTTCGTTCACCCCTCAGTTGCA
CGGGCTGACCATGTGGATCCCACTCTTGATGCTGCTCCATTTGATTCA
GTGAGTTCGATGTCCCAGAGTTATGAGGGTTGAGATTGATCAGTTGTTTCAGACTCCTTTCACTTTCGACTC
TCAATTCTTCCTCGAAGTACTCTTGGTCGGTGTTGGCTTCCCTGGACTTGACA
GTACGTATCAACGTCTTTTTAAAGCATGGAATTCTTGTCTCAATCCTCCGTAGATAATACTGGAGAA
CTCGCCTCTCCTCTCCCGCTTACGGTTGGGGACAACGTTGGAGAACTTCGTCTCCAATCCGACCATGCATTCGCTCACGATCCGCGAACGGCGTGCTTTTGGCAGGAAATGATCA
GTTGC
GTTCATAAATCTGCACTGCTTTTACTGAAACTCAATTCATTTTAAAACTTCTTTCCTACGTGCAGATCAAGAAGCTCTCATGGCTTCGAGATTCAAAGCCGCTATGGCCAAGATGGCTAT
CATTGGTCACAATGCTGAAGACTTGATTGATTGCTCGGCCGTTGTTCCCAAACCCGTTCCTGCTTTGAAGCAGGCTACTAC
GTGAGTACTCTTCGTTGCATTGCAGTGCGAAGGATCAAT
GCTGATGAAGTCTGGATTATTAGGTTCCCCGCTACTAAAAGCATCCGTGACGTTCAACAGTCTTGCCCATTACCTTTCCCAAGCCTTTCTACGGCTCGTAAGTTCTCGATTTGTTTGTGT
TATGTATTCGGTACTAAAGCGAATCTCATTCGCTTCTAGCTGGGGCATTGGAGAGTGAAATCCCGCATTGCCCCGACGGCCAGACGAGTTGCGATGTTGTAAGGAGCGGATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTTCATCGACACTACTGCTCTTCGCTGCGTTCGCTATTACTCTGACCAATGCAGCCCCGTCTCCTCATGCGGTCTGCTCTGACGGCACAGTCGTCAGTCATGCTTCGTGTTGC
GCCTTCATTCCC
TTGGCTCAAGATCTTACCGAGAATCTCTTTGAGAATGAGTGCGGTGAAACTGCTCACGAAGTCCTTCGTTTGAGCTTCCATGATGCAATTGCCTTTTCTCAATCTAAG
GGACGCTCGGC
TGGAGGAGGTGCAGATGGGAGCATGTTACTCTTCCCGGACGTCGAACCCAATTTTGCTGCCAATTTGGGAATTTCCGATAGCGTTAATGATCTCGCGCCCTTCCTCGCT
TCTGGGAAGTTTCCAACCATCACCGCGGGCGATATGATCCAGTTCGGAGCCGCCGTTGCTGTTGGGCTGTGTCCT
GGTGCACCCCAACTTGAATTCCTTGCTGGGCGTCCCAATGCTACT
GCGCCTGCGATTGATGGATTGATTCCCGAGCCACAAGATTCGGTCGACAAAATCCTTGCTCGTTTCCAGGATGCT
GCCAATATGAATGCCGAGGATATCGTTTCTTTGCTTACATCGTTC
GTTCACCCCTCAGTTGCACGGGCTGACCATGTGGATCCCACTCTTGATGCTGCTCCATTTGATTCA
ACTCCTTTCACTTTCGACTCTCAATTCTTCCTCGAAGTACTCTTGGTCGGTGTT
GGCTTCCCTGGACTTGACA
ATAATACTGGAGAACTCGCCTCTCCTCTCCCGCTTACGGTTGGGGACAACGTTGGAGAACTTCGTCTCCAATCCGACCATGCATTCGCTCACGATCCGCGA
ACGGCGTGCTTTTGGCAGGAAATGATCA
ATCAAGAAGCTCTCATGGCTTCGAGATTCAAAGCCGCTATGGCCAAGATGGCTATCATTGGTCACAATGCTGAAGACTTGATTGATTGCTCG
GCCGTTGTTCCCAAACCCGTTCCTGCTTTGAAGCAGGCTACTAC
GTTCCCCGCTACTAAAAGCATCCGTGACGTTCAACAGTCTTGCCCATTACCTTTCCCAAGCCTTTCTACGGCTCCT
GGGGCATTGGAGAGTGAAATCCCGCATTGCCCCGACGGCCAGACGAGTTGCGATGTTGTAAGGAGCGGATCTTAA

Retrieve as FASTA