Entry information : GluxMnP03
Entry ID 9749
Creation 2011-11-18 (Christophe Dunand)
Last sequence changes 2011-11-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: GluxMnP03
Name GluxMnP03
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxMnP03
start..stop
S start..stop
GluxMnP01 603 0 1..380 1..373
GluxMnP02 603 0 12..380 9..377
PbreMnP07 485 9e-173 1..382 1..373
DsMnP01 484 3e-172 13..382 11..376
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 246682..246822 141 N° 2 246570..246621 52 N° 3 246488..246514 27 N° 4 246392..246431 40
N° 5 246158..246341 184 N° 6 245988..246107 120 N° 7 245883..245928 46 N° 8 245719..245783 65
N° 9 245589..245661 73 N° 10 245406..245534 129 N° 11 245219..245354 136 N° 12 245078..245151 74
N° 13 244958..245019 62  
complement(join(244958..245019,245078..245151,245219..245354,245406..245534,2455 89..245661,245719..245783,245883..245928,245988..246107,246158..246341,246392..2 46431,246488..246514,246570..246621,246682..246822))


exon

Literature and cross-references GluxMnP03
DNA ref. JGI genome:   scaffold_63 (246822..244958)
Protein sequence: GluxMnP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (360)
PWM (Da):   %s   40031.79 (37714.5)  
PI (pH):   %s   4.05 (4.01) Peptide Signal:   %s   cut: 23 range:23-382
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYLSNVLPLAALVISFATTIKAAPASPDAVCSDGTVVSNTICCDFIPLARDLTENLFENECGETAHEVLRLSFHDAIAFSQSLGPSAGGGADGSMLIFPDVEPNYAANLGISDSVNDLAPFLASGKYPTISAGDMIQFGAAVAVGLCGAPQLEFLAGRRNATAPAIDGLIPEPQDSVSTILARFEDAANLDSEDVVSLLISVKSFPVARADHVDPTLADAPFDTPFTFDSQFFLETLLAPVGFPGTDNNTGEVASPLPLSVGNNVGEIRLQSDFELARDERTACFWQSMINQEELMAARFKAAMAKMAVIGHQASDLVNCSAVVPKPVPALRKPATYPATKSFKDIQQACPSPFPSLSTPGPLETIIPNCPDGQTTCTS

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATTTATCGAACGTTCTTCCCCTCGCTGCCCTCGTCATTAGTTTTGCAACTACAATCAAGGCAGCTCCTGCCTCACCAGACGCGGTCTGCTCTGATGGAACAGTCGTGAGCAATACT
ATATGTTGCGACTTCATTCCA
GTTTGTCTTTTTACACCATCTCTCGTAAACCGGAGCTTACTGACTCATAATTGGACCTAGCTTGCTCGAGATCTTACTGAAAATCTCTTCGAGAATGAA
TGCGGCGAAACAG
GTTAGTGGGGAGACGAATATGCTCAAAAAACAAAATACCTATGTACCGTCCGCAGCTCACGAAGTTCTTCGTCTAAGCTTTCGTATGTGCAAATTTTGTAAGGCCGA
TCATCCACATACCAATGGATATCTACACTAGATGATGCCATTGCTTTCTCCCAGTCCCTGGGCCCTTCGGCGTAAGTCCAGGGTGTGTACCTCAGCTCACGTGCTAACCCCTTCTCAAAA
GCGGAGGAGGTGCAGACGGTAGCATGCTGATCTTTCCAGATGTCGAACCTAACTACGCCGCCAACTTGGGCATCTCCGACAGCGTCAACGATCTTGCCCCTTTCCTAGCTTCTGGGAAAT
ATCCCACCATCTCTGCCGGCGATATGATTCAATTTGGTGCCGCCGTGGCGGTTGGTCTCTGCCCT
GTGCGCGCGTCTGTATTGATAGATGCACATTTTTCTTATCAACCTTTCAGGGCGC
ACCCCAATTAGAATTTCTTGCCGGACGACGAAATGCTACAGCTCCTGCAATTGACGGATTGATTCCAGAACCTCAGGATTCGGTCTCCACAATCCTTGCTCGATTTGAGGATGCA
GTACG
TTCTTTGTATCTCCCGCCTATTACTACGGTAACTGATGTCCTGGTTGTGCTCAGGCAAACCTCGATAGCGAGGATGTCGTGTCATTATTGATATCAGTTAGTAACCAACTTGATCGAGCA
TTTTTTCTCCTAATTTCTCTTCCAGCACACAGGTTCGGTCTCGTTTTATGATTGCTCATCGTTTCCTGGCCATCTGAAGAATCATTTCCAGTTGCGAGGGCAGACCATGTTGACCCCACC
CTTGCTGATGCGCCATTCGATTCG
GTGAGACAGATTTTCATGAGCTTCCGAGATGTCAAAGATTGACAATCTTCCTCGTAGACTCCGTTCACTTTCGACTCTCAATTCTTCCTCGAGACT
CTTTTGGCTCCTGTAGGGTTCCCTGGGACTGACA
GTATGTGCTCAATAGCTTGAGAGAGAAATAGACCCCAACCCTCAACTTTCTCAGACAATACTGGCGAAGTAGCTTCTCCCCTTCCA
CTTTCCGTCGGAAACAACGTTGGAGAGATTCGACTCCAATCAGACTTTGAGCTTGCTCGTGACGAGAGAACAGCCTGTTTCTGGCAGAGCATGATCA
GTGCGTCTAAAATAGCTTTTAAT
CCCAACTTCGAACCTTTGCTTTGATTAGATCAGGAAGAACTAATGGCAGCGAGGTTCAAAGCTGCTATGGCCAAAATGGCCGTCATTGGACACCAGGCATCGGATTTGGTTAACTGTTCA
GCTGTTGTACCGAAACCTGTTCCCGCTCTGAGAAAGCCCGCGAC
GTAAGTATCGTATCTTTCGAATTAAATGAATGATAAGCATCTCAACCGATCTTTCTCTTTTTTACAGGTATCCGGC
GACTAAGAGCTTCAAAGACATTCAACAAGCATGCCCGTCTCCTTTCCCAAGTCTCTCCACCGATC
GTGAGTCATTTGGTCTATTTATACCACAACAGAGATGAAACTGGAAGCCATATTA
CAGCCGGTCCTCTAGAGACTATAATTCCTAACTGTCCTGATGGTCAGACGACCTGCACATCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATTTATCGAACGTTCTTCCCCTCGCTGCCCTCGTCATTAGTTTTGCAACTACAATCAAGGCAGCTCCTGCCTCACCAGACGCGGTCTGCTCTGATGGAACAGTCGTGAGCAATACT
ATATGTTGCGACTTCATTCCA
CTTGCTCGAGATCTTACTGAAAATCTCTTCGAGAATGAATGCGGCGAAACAGCTCACGAAGTTCTTCGTCTAAGCTTTCATGATGCCATTGCTTTCTCC
CAGTCCCTGGGCCCTTCGGC
CGGAGGAGGTGCAGACGGTAGCATGCTGATCTTTCCAGATGTCGAACCTAACTACGCCGCCAACTTGGGCATCTCCGACAGCGTCAACGATCTTGCCCCT
TTCCTAGCTTCTGGGAAATATCCCACCATCTCTGCCGGCGATATGATTCAATTTGGTGCCGCCGTGGCGGTTGGTCTCTGCCCT
GGCGCACCCCAATTAGAATTTCTTGCCGGACGACGA
AATGCTACAGCTCCTGCAATTGACGGATTGATTCCAGAACCTCAGGATTCGGTCTCCACAATCCTTGCTCGATTTGAGGATGCA
GCAAACCTCGATAGCGAGGATGTCGTGTCATTATTG
ATATCAGTTA
AATCATTTCCAGTTGCGAGGGCAGACCATGTTGACCCCACCCTTGCTGATGCGCCATTCGATTCGACTCCGTTCACTTTCGACTCTCAATTCTTCCTCGAGACTCTTTTG
GCTCCTGTAGGGTTCCCTGGGACTGACA
ACAATACTGGCGAAGTAGCTTCTCCCCTTCCACTTTCCGTCGGAAACAACGTTGGAGAGATTCGACTCCAATCAGACTTTGAGCTTGCTCGT
GACGAGAGAACAGCCTGTTTCTGGCAGAGCATGATCA
ATCAGGAAGAACTAATGGCAGCGAGGTTCAAAGCTGCTATGGCCAAAATGGCCGTCATTGGACACCAGGCATCGGATTTGGTT
AACTGTTCAGCTGTTGTACCGAAACCTGTTCCCGCTCTGAGAAAGCCCGCGAC
GTATCCGGCGACTAAGAGCTTCAAAGACATTCAACAAGCATGCCCGTCTCCTTTCCCAAGTCTCTCC
ACCGATC
CCGGTCCTCTAGAGACTATAATTCCTAACTGTCCTGATGGTCAGACGACCTGCACATCCTAA

Retrieve as FASTA