Entry information : JargCIIBA01
Entry ID 9750
Creation 2011-11-18 (Christophe Dunand)
Last sequence changes 2011-11-18 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-26 (Nizar Fawal)
Peroxidase information: JargCIIBA01
Name JargCIIBA01
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Jaapiaceae Jaapia
Organism Jaapia argillacea    [TaxId: 202697 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value JargCIIBA01
start..stop
S start..stop
ParcCIIBA04 383 4.6e-133 29..344 29..340
DsCIIBA05 360 7.63e-124 8..345 5..341
PoCIIBA02_C9 353 1.97e-121 29..346 28..341
PoCIIBA02_PC15 353 2.04e-121 29..346 28..341
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9750' 'join(519294..519926,519977..520039,520098..520204,520265..520299,520363..520553,520628..520705)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 519294..519926 631 N° 2 519977..520039 61 N° 3 520098..520204 105 N° 4 520265..520299 33
N° 5 520363..520553 189 N° 6 520628..520705 76  
join(519294..519926,519977..520039,520098..520204,520265..520299,520363..520553, 520628..520705)


exon

Literature and cross-references JargCIIBA01
DNA ref. JGI genome:   scaffold_13 (519294..520705)
Protein sequence: JargCIIBA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (347)
PWM (Da):   %s   39306.44 (36978.1)  
PI (pH):   %s   5.2 (4.82) Peptide Signal:   %s   cut: 22 range:22-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLRKLTALIPHLSFFSAAFASPSPLFPCGSGQTTQNPTCCKWFD
VLEDLQTNLFSSGKCVKSAPRSLRLAFHDAIGYSPSFTSQGKWGGGGADGSIMTFSETESSYGANAGLEDIIEAE
RPFAIKHGVSFGDVIQFSSAVGLTNCPGSPRLAFLAGRPNA
TQPAPMGLVPAPSESVTGILARFADVGFGEEEVVALMAAHTIGGQAHIDP
TIPGMGFDSTPDKFDSQFYLETLLKGTMW
PGNGSHPGESMSPSKNEFRLESDWALA
RDVRTACEWVSVNYNTMIQKFTAAMKKLSLLGQNVDDLVDCSDVIPLSVSRPGAQWTEELVTLPDGMKLTDLEICKGFTGLSSMIGQSAVPRR
DRRTSH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACTCCGAAAGCTCACGGCTCTGATACCCCACCTATCTTTCTTTTCTGCTGCCTTTGCAAGCCCTTCACCACTATTCCCCTGTGGATCAGGTCAGACGACACAAAACCCTACCTGC
TGCAAATGGTTCGACGTCCTCGAAGACCTCCAAACAAACCTCTTTTCCTCCGGTAAATGTGTCAAATCCGCTCCTCGATCCCTCCGACTGGCCTTCCACGACGCAATCGGTTACTCTCCT
TCATTCACATCCCAAGGCAAATGGGGAGGCGGTGGCGCAGACGGCTCTATCATGACGTTCTCAGAAACGGAGTCCTCCTACGGCGCGAATGCAGGGCTGGAAGATATAATCGAAGCTGAA
CGCCCTTTCGCCATCAAACATGGTGTTTCATTCGGTGACGTCATACAATTCTCGTCTGCTGTTGGCTTGACCAATTGTCCTGGGTCTCCGAGGCTTGCTTTTTTGGCCGGACGACCGAAT
GCGACTCAGCCTGCTCCGATGGGCTTGGTTCCGGCTCCTTCTGAGTCTGTTACGGGTATACTCGCACGATTTGCGGATGTTGGGTTTGGAGAGGAGGAGGTCGTGGCGTTGATGGCTGCC
CATACCATCGGAGGGCAGGCACATATTGATCCG
CGGTGGGAGCAAGTATGGACATTCTAGGACGTTGTACTCATTGCAAGCATAGACAATTCCAGGTATGGGATTTGACTCAACTCCCGA
CAAGTTTGACAGTCAATTTTATCTTGAG
AGGTGAGCCACGCCGCAGCGTCACCAGTAGACGGAAGGTTACTGATAGACCCTTGTATAGACCCTCCTCAAAGGGACGATGTGGCCAGGAAA
CGGATCCCACCCTGGAGAATCAATGTCTCCGTCCAAGAACGAATTCAGGCTGGAGAGTGATTGGGCTTTGGCAAG
AGGTTCGGCCTTTCTTCACACCAACGTAAGACGCATATATTCAAC
TAAAATGACCCTCCCAGAGACGTCCGAACTGCTTGTGAATGGGTCTCACTCGCGGTCAGCTCAATTCTCCGATTCCCTCGATGTGATTCTGATCATGTCCGCGAATCTCTGCTACAGTCA
ACTACAACACGATGATCCAAAAGTTCACCGCAGCTATGAAGAAGTTGTCCCTTTTGGGTCAGAACGTCGACGATCTCGTTGATTGCTCTGATGTTATTCCACTTTCTGTATCGAGGCCAG
GGGCCCAGTGGACGGAAGAGCTTGTTACATTGCCCGATGGGATGAAGCTAACTGACTTGGAGATCAAG
AGGTCAGTTCCGAGTCGTCGTTCCATATCTCCGTCCTTATCTGATTCGACGC
GTTTGTTGCCACGCCTGCTTTTAGTGCAAGGGATTCACAGGCCTTTCTTCCATGATCGGACAGTCGGCGGTTCCACGTCGAGATCGACGGACATCGCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACTCCGAAAGCTCACGGCTCTGATACCCCACCTATCTTTCTTTTCTGCTGCCTTTGCAAGCCCTTCACCACTATTCCCCTGTGGATCAGGTCAGACGACACAAAACCCTACCTGC
TGCAAATGGTTCGACGTCCTCGAAGACCTCCAAACAAACCTCTTTTCCTCCGGTAAATGTGTCAAATCCGCTCCTCGATCCCTCCGACTGGCCTTCCACGACGCAATCGGTTACTCTCCT
TCATTCACATCCCAAGGCAAATGGGGAGGCGGTGGCGCAGACGGCTCTATCATGACGTTCTCAGAAACGGAGTCCTCCTACGGCGCGAATGCAGGGCTGGAAGATATAATCGAAGCTGAA
CGCCCTTTCGCCATCAAACATGGTGTTTCATTCGGTGACGTCATACAATTCTCGTCTGCTGTTGGCTTGACCAATTGTCCTGGGTCTCCGAGGCTTGCTTTTTTGGCCGGACGACCGAAT
GCGACTCAGCCTGCTCCGATGGGCTTGGTTCCGGCTCCTTCTGAGTCTGTTACGGGTATACTCGCACGATTTGCGGATGTTGGGTTTGGAGAGGAGGAGGTCGTGGCGTTGATGGCTGCC
CATACCATCGGAGGGCAGGCACATATTGATCCG
ACAATTCCAGGTATGGGATTTGACTCAACTCCCGACAAGTTTGACAGTCAATTTTATCTTGAGACCCTCCTCAAAGGGACGATGTGG
CCAGGAAACGGATCCCACCCTGGAGAATCAATGTCTCCGTCCAAGAACGAATTCAGGCTGGAGAGTGATTGGGCTTTGGCAAG
AGACGTCCGAACTGCTTGTGAATGGGTCTCACTCGTC
AACTACAACACGATGATCCAAAAGTTCACCGCAGCTATGAAGAAGTTGTCCCTTTTGGGTCAGAACGTCGACGATCTCGTTGATTGCTCTGATGTTATTCCACTTTCTGTATCGAGGCCA
GGGGCCCAGTGGACGGAAGAGCTTGTTACATTGCCCGATGGGATGAAGCTAACTGACTTGGAGATCAAG
TGCAAGGGATTCACAGGCCTTTCTTCCATGATCGGACAGTCGGCGGTTCCA
CGTCGAGATCGACGGACATCGCACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGTCTTTT CAATTCCAAC ATTTGACCAT CCATCCTCCC TGCCCTCCCT TCTGCCCTCT CCGGCAGCTT CACACTCTTT TCTCGATTCC TTTTTCTATT TCACCGCACC ACAATGCTAC  TCCGAAAGCT CACGGCTCTG ATACCCCACC TATCTTTCTT TTCTGCTGCC TTTGCAAGCC CTTCACCACT ATTCCCCTGT GGATCAGGTC AGACGACACA AAACCCTACC TGCTGCAAAT  GGTTCGACGT CCTCGAAGAC CTCCAAACAA ACCTCTTTTC CTCCGGTAAA TGTGTCAAAT CCGCTCCTCG ATCCCTCCGA CTGGCCTTCC ACGACGCAAT CGGTTACTCT CCTTCATTCA  CATCCCAAGG CAAATGGGGA GGCGGTGGCG CAGACGGCTC TATCATGACG TTCTCAGAAA CGGAGTCCTC CTACGGCGCG AATGCAGGGC TGGAAGATAT AATCGAAGCT GAACGCCCTT  TCGCCATCAA ACATGGTGTT TCATTCGGTG ACGTCATACA ATTCTCGTCT GCTGTTGGCT TGACCAATTG TCCTGGGTCT CCGAGGCTTG CTTTTTTGGC CGGACGACCG AATGCGACTC  AGCCTGCTCC GATGGGCTTG GTTCCGGCTC CTTCTGAGTC TGTTACGGGT ATACTCGCAC GATTTGCGGA TGTTGGGTTT GGAGAGGAGG AGGTCGTGGC GTTGATGGCT GCCCATACCA  TCGGAGGGCA GGCACATATT GATCCGACAA TTCCAGGTAT GGGATTTGAC TCAACTCCCG ACAAGTTTGA CAGTCAATTT TATCTTGAGA CCCTCCTCAA AGGGACGATG TGGCCAGGAA  ACGGATCCCA CCCTGGAGAA TCAATGTCTC CGTCCAAGAA CGAATTCAGG CTGGAGAGTG ATTGGGCTTT GGCAAGAGAC GTCCGAACTG CTTGTGAATG GGTCTCACTC GTCAACTACA  ACACGATGAT CCAAAAGTTC ACCGCAGCTA TGAAGAAGTT GTCCCTTTTG GGTCAGAACG TCGACGATCT CGTTGATTGC TCTGATGTTA TTCCACTTTC TGTATCGAGG CCAGGGGCCC  AGTGGACGGA AGAGCTTGTT ACATTGCCCG ATGGGATGAA GCTAACTGAC TTGGAGATCA AGTGCAAGGG ATTCACAGGC CTTTCTTCCA TGATCGGACA GTCGGCGGTT CCACGTCGAG  ATCGACGGAC ATCGCACTAG GCATTAGCAT CTGCACATCG CTATTCTACA AATCTCCGCT CTTTGCCCTC GTATTTTTTA CATAGCTATG GACGTACTCA CCGGAGCAGT TTCGCCTCCG 
TCTCTGAGAT TTGCAATGTT GGACCCTTCT TCGAGGCTAT CTTGAGCGCT CAC 

Retrieve as FASTA