Entry information : GmPrx[P]318
Entry ID 9751
Creation 2011-10-06 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-18 (Qiang Li)
Peroxidase information: GmPrx[P]318
Name GmPrx[P]318
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]318
start..stop
S start..stop
GmPrx320 268 5e-91 69..210 181..320
GmPrx320 128 3e-36 3..69 1..67
MtPrx66 247 1e-82 60..210 171..320
MtPrx66 104 4e-27 7..69 5..67
NnPrx99 240 5e-80 69..210 184..323
NnPrx99 83 3e-19 6..69 5..70
LjPrx51 239 1e-79 69..210 183..322
LjPrx51 90 8e-22 6..69 5..69
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9356972..9357175 204 N° 2 9357446..9357867 422  
join(9356972..9357175,9357446..9357867)


exon

Literature and cross-references GmPrx[P]318
DNA ref. Phytozome 12:   Gm17 (9356972..9357867)
Protein sequence: GmPrx[P]318
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   209 (188)
PWM (Da):   %s   22659.47 (20397.3)  
PI (pH):   %s   7.88 (7.88) Peptide Signal:   %s   cut: 22 range:22-209
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMDAILGYLIILVMTSAVQAQLKAGFYSTPCPNAEAIVGSTVVSHFSKDLTIAPGLLRLHFHDCFVQGAHTIGQTECRFFSYRLYNFTTSGSPDPTINVAFLAQLQALCPKNGDGLRRVALDKDSQAKFDVSFFKNVRDGxNGVLESDQRLWADSSTQSVVQNYAGNVxRG*LGLRFDFEFPKAMIKLSSIEVKTGTDGEIREVCSKFN

Retrieve as FASTA  
Remarks Psedogene from genomic. Incorrect prediction from phytozome (Exon 2 was missing which was not found in genomic; Frame shift in Exon 4).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGGATGCCATATTGGGCTACCTAATAATTTTAGTGATGACTTCGGCAGTACAAGCCCAATTGAAAGCTGGGTTTTATTCTACTCCATGTCCAAATGCTGAGGCAATTGTAGGG
TCCACCGTTGTATCCCACTTCAGCAAAGATCTAACCATTGCTCCTGGCCTGCTCAGGCTTCATTTCCATGATTGCTTTGTCCAA
GTAAGTTAATCTCAACCTCAAATCCTTCACTCACGT
AAAGCCGTAAATGTATAAAAGAAGAGGTGTATGAACACTTAAAAAATGAGAAACTATACATCAAGATTAAAAATGGCCAACATATATATCTTAGTAATAAACTATGAGTTGTTAACATTT
GTTCTTCTAATTTTTACTCAACATTTAACAATTATAATTTGACTTCACTTTCTTCATAGTGATCAAGTCTTAATTTCTTTTCCTAAAAGTATATGACTTATTTGACTGTCTTCGGGTGCA
CATACCATAGGCCAGACAGAATGCAGATTCTTCAGTTATCGTCTATACAATTTCACAACCTCTGGTAGTCCTGATCCCACTATAAACGTAGCTTTTTTAGCTCAACTTCAAGCACTTTGT
CCAAAAAATGGAGATGGCTTGAGAAGGGTGGCCTTGGACAAAGATAGTCAAGCTAAATTTGATGTTAGTTTCTTCAAGAATGTGCGTGATGGTANNAATGGGGTTCTTGAGTCAGACCAG
AGGTTGTGGGCAGATTCTTCTACTCAAAGTGTGGTGCAAAATTATGCTGGGAATGTTANNAGAGGGTAACTGGGGTTGAGGTTTGACTTTGAATTTCCAAAGGCCATGATTAAGTTAAGT
AGCATAGAGGTGAAGACTGGTACTGATGGAGAGATCAGAGAAGTGTGTTCAAAATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGGATGCCATATTGGGCTACCTAATAATTTTAGTGATGACTTCGGCAGTACAAGCCCAATTGAAAGCTGGGTTTTATTCTACTCCATGTCCAAATGCTGAGGCAATTGTAGGG
TCCACCGTTGTATCCCACTTCAGCAAAGATCTAACCATTGCTCCTGGCCTGCTCAGGCTTCATTTCCATGATTGCTTTGTCCAA
GGTGCACATACCATAGGCCAGACAGAATGCAGATTC
TTCAGTTATCGTCTATACAATTTCACAACCTCTGGTAGTCCTGATCCCACTATAAACGTAGCTTTTTTAGCTCAACTTCAAGCACTTTGTCCAAAAAATGGAGATGGCTTGAGAAGGGTG
GCCTTGGACAAAGATAGTCAAGCTAAATTTGATGTTAGTTTCTTCAAGAATGTGCGTGATGGTANNAATGGGGTTCTTGAGTCAGACCAGAGGTTGTGGGCAGATTCTTCTACTCAAAGT
GTGGTGCAAAATTATGCTGGGAATGTTANNAGAGGGTAACTGGGGTTGAGGTTTGACTTTGAATTTCCAAAGGCCATGATTAAGTTAAGTAGCATAGAGGTGAAGACTGGTACTGATGGA
GAGATCAGAGAAGTGTGTTCAAAATT

Retrieve as FASTA