Entry information : TsPrx69 (Thhalv10004557m)
Entry ID 9752
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: TsPrx69 (Thhalv10004557m)
Name (synonym) TsPrx69 (Thhalv10004557m)
Class Class III peroxidase    [Orthogroup: Prx076]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx69
start..stop
S start..stop
ThPrx69 667 0 1..333 1..333
BrPrx70-1Ab_other 589 0 1..334 1..334
BstrPrx15 568 0 1..334 1..334
BrPrx69-1Aa_other 560 0 1..334 1..335
Gene structure Fichier Exons


exon

Literature and cross-references TsPrx69 (Thhalv10004557m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 12:   scaffold_6 (1398849..1400185)
EST ref. GenBank:   BAJ34593
Protein sequence: TsPrx69 (Thhalv10004557m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (310)
PWM (Da):   %s   36001.65 (33450.3) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.85 (9.97) Peptide Signal:   %s   cut: 24 range:24-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRGYDLLFSLVTFLVLVAAVTAQGNRGSSRRGGRTPRVGFYGNRCRNVESIVSSVVRSHVRSNPANAPGILRMHFHDCFVRGCDGSILLAGNTTERNAIPNRSLRGFEAIEEAKARLED
ACPGTVSCADILTLAARDVVVLTGGQGWRVPLGRLDGRISQASDVILPGPFDSVDKQKRDFAAKTLNTLDLVTLVGGHTIGTAGCGLVRGRFFNFNGTGQPDPSIDPSFVPLVQARCPQN
GDATTRVDLDAGSAGRFDTSFLRNVRSSRVVLQSDLVLWSDPETRAIIERLLGLRFPFLRFGSEFARSMIKMSLIEVKTGSDGEIRRVCSAIN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic and 1 EST.
DNA
Send to BLAST
CDS
Send to BLAST