Entry information : TsPrx07 (Thhalv10008077m)
Entry ID 9757
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: TsPrx07 (Thhalv10008077m)
Name (synonym) TsPrx07 (Thhalv10008077m)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx07
start..stop
S start..stop
BrPrx07-1Ac_other 605 0 1..350 1..342
BrPrx07-1Ab_other 600 0 1..350 1..347
BrPrx07-1Aa_other 596 0 1..350 1..351
BstrPrx10 583 0 17..350 17..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3930561..3930851 291 N° 2 3929244..3930005 762  
complement(join(3929244..3930005,3930561..3930851))


exon

Literature and cross-references TsPrx07 (Thhalv10008077m)
DNA ref. Phytozome 12:   scaffold_5 (3930851..3929244)
Protein sequence: TsPrx07 (Thhalv10008077m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (327)
PWM (Da):   %s   38844.73 (36337.2) Transmb domain:   %s   i5-22o
PI (pH):   %s   5.77 (5.50) Peptide Signal:   %s   cut: 24 range:24-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLAVVSVVVLLVILVAWPVSAGKKDLPEVGGYGGEEEEDDTNSWFPLDNLLSLSYYDKICPNFEKIVDTKVREWTKRDSTLGPALLRLVFHDCGVTGCDASVLLDHEGSERKSPASKTLRGFELIEDIKSEMEKSCKGLVSCADILIAASRDATYQLGGPYWPNAYGRRDSKNSYARDVEKVPSGRRDVTGLLETFQSYGLNILDLVVLSGAHTIGKANCGTIQSRLYNFNATHGTDPAIDTKLADYLRRKCRWDSETVDLDVVTPVTFDNQYYVNLQKHMGVLTTDQELVKDPRTAPLVKAFAEQPPQMFKQQFAVSMAKLVNVGVITGEDRDGEIRRVCSKPNSKSY*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTGGCCGTGGTCTCAGTCGTCGTCCTACTCGTGATTCTCGTGGCCTGGCCGGTATCGGCTGGCAAAAAAGACTTACCTGAAGTAGGAGGATACGGAGGCGAGGAGGAGGAAGAT
GACACAAACTCATGGTTTCCTTTGGACAATCTATTATCGTTGAGTTATTATGATAAGATTTGTCCGAATTTTGAGAAAATCGTTGATACCAAAGTGAGAGAATGGACAAAGAGAGACTCT
ACCCTCGGGCCCGCCCTCCTCCGCCTTGTTTTCCACGATTGCGGCGTCACG
GTATAGCAATTATATCTTCTTTCGTAAGCTTTTATACAATAGTAATAATCATTCAGTTGTGTATAGTAC
TCAATATATACGATAGTCCATATGCTATATATAGGTAGCTTATGTTTTGGATTCATATATCATATATGTATTGTATAGTTTGCATTGTCTACAAATGGGTGTAAATTGAAGGTTATTAGG
ATTCATATTGGTAAATGGTAACATTTTCAAATTTTGGAATGATGGAATTCCATGACATAAACTGAAAAACTTGATATAACTGAATTCCATGAAATGATGGAATTCATTTGATTTTAATCG
CTAACTTTATATACATAAATAACGATTTTGCTTTATTATGTGAAATCACGTAACCATTCGTTGAGTTACCCACCAAAGGTCCAAAACCTAACATTAATAGTCAGTAAGAAAATAAGTTTC
TCCATATTGAAGATGGAGTTATGCAATTTCTTCTATGCATAAACGCACCTCATTGTTTTAAACATATCTATAATATACACATTTTCAAAGGTAACACAACTCTTTTGTGGAAATGACAAC
TTTCAGGGATGTGATGCGTCGGTTCTTCTAGACCACGAAGGATCAGAGAGAAAATCTCCGGCGAGCAAAACCCTAAGAGGCTTCGAGCTAATCGAAGATATCAAGTCCGAGATGGAGAAA
TCTTGCAAAGGATTAGTCTCCTGCGCCGACATCCTAATCGCAGCTAGCCGCGACGCAACCTACCAACTCGGTGGTCCTTACTGGCCAAACGCCTACGGTCGTCGTGACTCCAAGAACTCA
TACGCTAGAGACGTTGAGAAAGTCCCTTCAGGCCGCCGTGACGTCACCGGTCTTCTGGAGACGTTTCAGTCTTATGGACTCAACATCCTCGACCTAGTTGTCCTCTCCGGAGCACACACC
ATCGGAAAAGCCAACTGTGGAACCATCCAGTCTAGGCTTTACAACTTCAACGCAACACATGGAACTGATCCGGCCATTGACACCAAATTGGCAGATTACTTGCGTCGCAAGTGTCGTTGG
GATTCCGAGACCGTTGACCTAGACGTCGTGACTCCGGTTACGTTCGATAATCAGTATTACGTTAATCTTCAGAAGCATATGGGAGTTTTGACGACTGATCAGGAGCTTGTGAAGGACCCG
AGGACCGCTCCGCTTGTGAAGGCTTTCGCCGAGCAGCCGCCTCAGATGTTCAAGCAGCAGTTTGCTGTGTCGATGGCTAAGCTGGTCAATGTTGGTGTTATTACTGGTGAAGACCGTGAC
GGAGAGATCAGGAGGGTTTGTAGCAAACCAAACTCCAAATCTTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTGGCCGTGGTCTCAGTCGTCGTCCTACTCGTGATTCTCGTGGCCTGGCCGGTATCGGCTGGCAAAAAAGACTTACCTGAAGTAGGAGGATACGGAGGCGAGGAGGAGGAAGAT
GACACAAACTCATGGTTTCCTTTGGACAATCTATTATCGTTGAGTTATTATGATAAGATTTGTCCGAATTTTGAGAAAATCGTTGATACCAAAGTGAGAGAATGGACAAAGAGAGACTCT
ACCCTCGGGCCCGCCCTCCTCCGCCTTGTTTTCCACGATTGCGGCGTCACG
GGATGTGATGCGTCGGTTCTTCTAGACCACGAAGGATCAGAGAGAAAATCTCCGGCGAGCAAAACCCTA
AGAGGCTTCGAGCTAATCGAAGATATCAAGTCCGAGATGGAGAAATCTTGCAAAGGATTAGTCTCCTGCGCCGACATCCTAATCGCAGCTAGCCGCGACGCAACCTACCAACTCGGTGGT
CCTTACTGGCCAAACGCCTACGGTCGTCGTGACTCCAAGAACTCATACGCTAGAGACGTTGAGAAAGTCCCTTCAGGCCGCCGTGACGTCACCGGTCTTCTGGAGACGTTTCAGTCTTAT
GGACTCAACATCCTCGACCTAGTTGTCCTCTCCGGAGCACACACCATCGGAAAAGCCAACTGTGGAACCATCCAGTCTAGGCTTTACAACTTCAACGCAACACATGGAACTGATCCGGCC
ATTGACACCAAATTGGCAGATTACTTGCGTCGCAAGTGTCGTTGGGATTCCGAGACCGTTGACCTAGACGTCGTGACTCCGGTTACGTTCGATAATCAGTATTACGTTAATCTTCAGAAG
CATATGGGAGTTTTGACGACTGATCAGGAGCTTGTGAAGGACCCGAGGACCGCTCCGCTTGTGAAGGCTTTCGCCGAGCAGCCGCCTCAGATGTTCAAGCAGCAGTTTGCTGTGTCGATG
GCTAAGCTGGTCAATGTTGGTGTTATTACTGGTGAAGACCGTGACGGAGAGATCAGGAGGGTTTGTAGCAAACCAAACTCCAAATCTTACTAA

Retrieve as FASTA