Entry information : TsAPx01 (Thhalv10008402m)
Entry ID 9762
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: TsAPx01 (Thhalv10008402m)
Name (synonym) TsAPx01 (Thhalv10008402m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsAPx01
start..stop
S start..stop
CagraAPx01 505 0 1..250 1..250
TparAPx01 504 0 1..250 1..250
BstrAPx01 501 0 1..250 1..250
AhalAPx02 500 0 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13159417..13159535 119 N° 2 13159156..13159330 175 N° 3 13158988..13159053 66 N° 4 13158676..13158810 135
N° 5 13158504..13158583 80 N° 6 13158307..13158409 103 N° 7 13158152..13158210 59 N° 8 13158044..13158059 16
complement(join(13158044..13158059,13158152..13158210,13158307..13158409,1315850 4..13158583,13158676..13158810,13158988..13159053,13159156..13159330,13159417..1 3159535))


exon

Literature and cross-references TsAPx01 (Thhalv10008402m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 12:   scaffold_5 (13159535..13158044)
EST ref. GenBank:   BAJ33866
Protein sequence: TsAPx01 (Thhalv10008402m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27592.78  
PI (pH):   %s   5.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTMRFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGREDKPEPPPEGRLPDATKGCDHLRDVFAKQMGLTDKDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLTGEKEGLIQLVSDKALLDDPVFRPLVEKYAADEDAFFADYTEAHLKLSELGFADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAACTGTGAGCGAAGATTACCTAAAGGCTATTGAGAAGTGCAGGAGGAAGCTTAGAGGCATGATCGCTGAGAAGAACTGTGCACCCATCATGGTCCGCCTCGCG
TAAGTCACTGACCTTATCAGCTTGCGGTTTCTGAAGTAAATATGATGTGCACTTTCTCATGGCTTATCTGTTTGGCTCACTGCAGATGGCACTCTGCTGGAACATTCGATTGCGCCTCAA
GGACTGGAGGTCCCTTCGGAACAATGAGGTTTGATGCTGAGCAAGCTCATGGAGCCAACAGTGGTATCCACGTTGCTCTCAGGTTTTTGGAGCCCATACGGGAGCAATTCCCTACCATCT
CTTTTGCTGATTTCCATCAG
GTACATGTTTTAAAGAGATAACCTCTTTGGTTAGTGGTGATAACTCCAGTGTTGCTTGGATTCTAACTCACGATGTCCTTTGACATGAAATTGATCATTC
AGCTTGCTGGTGTTGTGGCCGTTGAAGTCACTGGTGGACCTGAAATTCCTTTCCACCCAGGAAGAGAGGTTAGTCATTGTTTTAGATAGATTTGTATCATCATATGCGCAAATGATCGAG
AAAACGTGTTATGCTGATTAAATGAGAGTGTAGCCATTCTCCTAGCCTATTTGTAATATCAAAATTGAAGAAGGGAACACTATGAGACTTGATTGCGTTTTACTAATATCCATATCTTGT
TTCAGGACAAGCCCGAGCCACCTCCAGAGGGTCGTCTTCCTGATGCTACAAAGGGTTGTGACCACTTAAGAGACGTCTTTGCAAAGCAGATGGGTTTAACTGACAAGGACATTGTCGCTT
TATCTGGTGCCCACACTCTG
GTTCGTTTCACTCCCAACTACTGCTTAAACACTTTCTTTGTTGGTTCCAATCGTCAAAGTGTGATGAATGCTTGCAAATTTGGGTAACACAGGGGAGATG
CCACAAGGATAGGTCTGGCTTCGAAGGTGCCTGGACTTCAAACCCTCTTATTTTCGACAATTCATACTTCAA
GTGAGTATCCCAAAGTTTCCACAAGTCTGCTAGGTTTTGATTCATCTT
TGGATTCATTGCTGATATGTTATTAACCGATGATATATATAACCAGGGAACTCTTGACCGGAGAGAAGGAAGGCCTTATTCAGCTTGTCTCTGACAAGGCGCTATTGGACGATCCTGTTT
TCCGTCCTTTGGTTGAGAAATACGCTGCT
GTATGCATCCTTTCTTTCTTTTTTGTTTTTTTTCTTTCTCTTTTTTTTGGAATTGGTATAATAGAGAACTCATGTTGCTTGCCACAATGTG
AACAGGACGAAGACGCCTTTTTTGCTGATTACACTGAGGCTCACTTGAAGCTTTCAGAGCTCGGGTACTTATTGATGAATATCTGAATCAGAGAGTAGAAGTAAATCCAAATTGAATTGT
ATGATGATACGAGTTTGTATCTACTGTTTGTTGCAGGTTTGCTGATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAACTGTGAGCGAAGATTACCTAAAGGCTATTGAGAAGTGCAGGAGGAAGCTTAGAGGCATGATCGCTGAGAAGAACTGTGCACCCATCATGGTCCGCCTCGCA
TGGCACTCTGCTGGAACATTCGATTGCGCCTCAAGGACTGGAGGTCCCTTCGGAACAATGAGGTTTGATGCTGAGCAAGCTCATGGAGCCAACAGTGGTATCCACGTTGCTCTCAGGTTT
TTGGAGCCCATACGGGAGCAATTCCCTACCATCTCTTTTGCTGATTTCCATCAG
CTTGCTGGTGTTGTGGCCGTTGAAGTCACTGGTGGACCTGAAATTCCTTTCCACCCAGGAAGAGAG
GACAAGCCCGAGCCACCTCCAGAGGGTCGTCTTCCTGATGCTACAAAGGGTTGTGACCACTTAAGAGACGTCTTTGCAAAGCAGATGGGTTTAACTGACAAGGACATTGTCGCTTTATCT
GGTGCCCACACTCTG
GGGAGATGCCACAAGGATAGGTCTGGCTTCGAAGGTGCCTGGACTTCAAACCCTCTTATTTTCGACAATTCATACTTCAAGGAACTCTTGACCGGAGAGAAGGAA
GGCCTTATTCAGCTTGTCTCTGACAAGGCGCTATTGGACGATCCTGTTTTCCGTCCTTTGGTTGAGAAATACGCTGCT
GACGAAGACGCCTTTTTTGCTGATTACACTGAGGCTCACTTG
AAGCTTTCAGAGCTCGG
GTTTGCTGATGCTTAA

Retrieve as FASTA