Entry information : TsPrx17 (Thhalv10000239m)
Entry ID 9770
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: TsPrx17 (Thhalv10000239m)
Name (synonym) TsPrx17 (Thhalv10000239m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx17
start..stop
S start..stop
AlyPrx17 621 0 4..327 3..327
AhalPrx10 621 0 4..329 3..329
AtPrx17 618 0 4..327 3..327
CagraPrx02 612 0 4..329 3..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 899923..900126 204 N° 2 900214..900405 192 N° 3 900489..901082 594  
join(899923..900126,900214..900405,900489..901082)


exon

Literature and cross-references TsPrx17 (Thhalv10000239m)
DNA ref. Phytozome 12:   scaffold_15 (899923..901082)
Protein sequence: TsPrx17 (Thhalv10000239m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (309)
PWM (Da):   %s   36720.45 (34476.1)  
PI (pH):   %s   5.5 (5.52) Peptide Signal:   %s   cut: 21 range:21-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLLPHLVLYLLLLTVVTGETLQPRFYSETCPEAESIVRREMKKAMIKEARSVASVMRLQFHDCFINGCDASLLLDDTPNMLGEKLSLSNINSLRSFEVVDDIKEALERACPATVSCADIIIMASRDAVALTGGPDWEVKLGRKDSLTASQKDSDDVMPSPRANATFLIDLFKRFDLSVKDMVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPALEPGYKKKLNKLCPLSVDQNVTGDLDATPQVFDNQYFKDLVSGRGFLNSDQTLYTNRETREYVKMFSEDQGEFFRAFEEGMVKMGDLQSGRPGEVRFNCRVVNRRPIHGLLEA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATAATGATC CGGACGCTTC CCAGTATCTT ATTTAGATGC GGATTCCACT CGCTTCCCGC GAATCACGCT TCCACTCGCG ACCCTTCGTT TCCCAAGTCG ACCGTTGCTT TTTGCGACTC  TTCATTTCCC AAGTCGACCG TTGCTTTTTG CGATTCTTTG TTGACAACGT TAAGGATTAC ACGCCATTCC CCGACTCCCA AGTATCACCT CGATTCCGAA GACCCCACAT CGATATCGAG  GTCCAGAGAA TTGGAAGGTC TCCAACTCGA TGCGTTGAAT ATCGAAGTAA CATCTCCATC AACGGACTGG GGGGGACAAT TGTTGTAGGT GGGCTGAGCA CAGCCTCCTT TTCTGTAATT  TCGACCAGGC CCATTAGCAA ATACAAAAAG CCCAACAAGA CCGAAAATGG ACGAGCCCAT TCGCCAAGCC AAAACGAGGT CGTTCGAAGA GATGAGCCTC CCGTATCGAA GGAGCAGCTC  GCCACGTCGA TGTTGATGAA ACAGCTCGCC ACGTCGACGT AGAGGAAATA GCTCGCCAGC GCGACATTCC GATAGACGGT CGGTCAGGTC TATCTACCCG GCCGCCCAAG CTAATCTGAC  CGAGATGTAA CCTAATTTGA ACACTATAAA TAGCTCTGTA ACTTTATTTA TCACGGGATC CGTAATCTGA AATAAAAACT AAAAACTCGA AACTTGTGAT CACTAACTCT TACCTCGCTT  AGTAGATCTC GCTTAAAAAA CCTCGATAAG ACCACATCGA CTTCACTTCT ATCTAACAAG AATCTCCGAG CTCCACCTAA TTATATTTAC CGAATTAACC TTGTGTGGGG ATACTAAACA  ACAACACTAA TTACTCATTG GGACCAAATA GATAAGAAGG AATTAATAAA AATTTATAAA TGACATTTGG AAACGACATT TGGGTTTTTA TGTTCCTTTT GTGGGATGAT TGTACCCTTT  GCTGGGTTTT CTCTCATTTG ATTTCTTAGG CATTTGGGAA GCTCACCACC ACACTTAACA AAAAATCCAT TTAAAGAAAA GCGTTAGAAA TTTAGAAATC ATTCTCGAAA ACCAATTCCA  CAGCTATATA ATTTGTTAAT TTGATAGAAG CTCTTTTAAG CAGAAATATG GTAGAAAAAG AAAACTACTC TAGGTTTTGT TGAAACCAAC CAATATAAAA TTAAAATTAA AGTGGACAAA  TGTCAGAAAT TTTTAGAACT ACATATGTAA AAAAAAGTAT ATACTCTTTT GCTCGACTTA TTGGAGGATC CCATTGGCGT GCATCCAGTA GGAATTGAAT TTTCTTTTTT TGACAAACAA  TATTTTTTTA TTTCGTCCTT TGCATACCAT ACATGCCCTC CAATTATATC TTCCAAATCG TCCACATTAA GTCATTAAAT GAATATGTTT GCGACGCTGA GATGTGCCCG AATAGGTAAG  ATCTCATTTA CTCTTACTTT TATTTCATCT TGTTTTTTCT TTATTTTATA ATCAAATAAA AAAACAAATT TCCCAATTTT TTCCCACTTT CTTAAAATCA AACGAGTCAA ACCCAGAGTA  ATCCTTTCTT CTTTTGGATA ACTATAGTAG ACTAAAATAC TCCACTAATT AATAATTTTA ATTCATTCCT CAGTTTATTT ACAATGTTTG AACAAATACT ACATTTATCG TCTTAATGAC  TACACTAATT ATCCATTGGG ACCAAATAGA TAAGAAGGAA TTAATAAAAT TTATAAAATG ACATTTGGAC ACTACCTTTG GGTTTTGATG TTTCCTTTTT GTGGGATGAT TGTACCCTTT  GCTGGGTTTT CTCTCATTTA ATTTCCTAAG CATTTGGGAA GCTCACCACC ACACTTAACA CAAAATCCAT TAGGAATTTA GAAATCATTC TCGAAACCCA CAAAAAAAAA ATTCTTTATA 
AAACCAACAA AGTGTCTGCT TCTTCCATCA CTGAAAACCA AACACGAAAA AAAAAATATT ATTATAAAAT TAGAAAAAAG T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTTCTTCCCCATCTTGTCCTTTACCTACTTCTCTTGACGGTGGTTACCGGAGAAACTCTCCAACCAAGATTCTACAGCGAAACATGCCCTGAAGCTGAATCCATAGTAAGA
AGAGAAATGAAGAAAGCCATGATCAAAGAAGCAAGAAGCGTCGCTTCCGTTATGCGTCTCCAATTTCACGACTGTTTCATCAAT
GTAAAATCATACCAATCTTTTCTTCTCTCTCTCTCT
CTTCTTGATTTTTTTTTACCTTCTGATTTCTCCGATGATAAATCAAATCAGGGATGTGACGCGTCTCTGTTGCTTGACGACACACCGAACATGCTTGGTGAAAAACTATCACTTTCCAAC
ATCAATTCACTGAGATCTTTCGAAGTTGTTGACGACATTAAAGAAGCTTTAGAGAGAGCTTGTCCTGCTACTGTTTCTTGCGCCGACATCATTATCATGGCTTCTCGTGACGCCGTTGCT
CTG
GTAAAAATCTCAACTTTTTCTCCAATTTCCTCCGGTTTGGTGATTTTTGTTCGGTTTCGTAAATTTTGGTTCTTGAAAACCAGACAGGAGGACCGGATTGGGAAGTGAAGTTAGGGA
GGAAAGACAGTTTAACGGCGAGTCAGAAAGATTCAGACGATGTAATGCCGAGTCCAAGAGCAAACGCAACTTTCTTGATTGATCTCTTCAAAAGATTCGATCTTTCTGTTAAAGACATGG
TGGCTTTATCTGGGTCACACTCAATTGGTCAAGGCCGGTGTTTTTCGATCATGTTCAGGCTTTATAACCAATCCGGGTCAGGTAAACCGGATCCAGCTCTTGAACCGGGTTACAAGAAGA
AGCTTAACAAGCTTTGTCCTTTGAGTGTAGACCAGAACGTGACGGGAGATCTAGACGCAACGCCACAGGTTTTTGATAATCAGTACTTCAAAGACTTGGTTTCAGGGAGAGGGTTTCTTA
ACTCGGACCAGACTCTGTACACGAACAGAGAGACGAGAGAGTATGTGAAGATGTTTAGTGAGGATCAAGGAGAGTTCTTTAGAGCATTTGAAGAAGGGATGGTGAAGATGGGTGATTTGC
AATCTGGGAGACCTGGTGAGGTTAGGTTTAATTGTAGGGTTGTTAATAGAAGGCCTATTCATGGATTGCTCGAGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTTCTTCCCCATCTTGTCCTTTACCTACTTCTCTTGACGGTGGTTACCGGAGAAACTCTCCAACCAAGATTCTACAGCGAAACATGCCCTGAAGCTGAATCCATAGTAAGA
AGAGAAATGAAGAAAGCCATGATCAAAGAAGCAAGAAGCGTCGCTTCCGTTATGCGTCTCCAATTTCACGACTGTTTCATCAAT
GGATGTGACGCGTCTCTGTTGCTTGACGACACACCG
AACATGCTTGGTGAAAAACTATCACTTTCCAACATCAATTCACTGAGATCTTTCGAAGTTGTTGACGACATTAAAGAAGCTTTAGAGAGAGCTTGTCCTGCTACTGTTTCTTGCGCCGAC
ATCATTATCATGGCTTCTCGTGACGCCGTTGCTCTG
ACAGGAGGACCGGATTGGGAAGTGAAGTTAGGGAGGAAAGACAGTTTAACGGCGAGTCAGAAAGATTCAGACGATGTAATGCCG
AGTCCAAGAGCAAACGCAACTTTCTTGATTGATCTCTTCAAAAGATTCGATCTTTCTGTTAAAGACATGGTGGCTTTATCTGGGTCACACTCAATTGGTCAAGGCCGGTGTTTTTCGATC
ATGTTCAGGCTTTATAACCAATCCGGGTCAGGTAAACCGGATCCAGCTCTTGAACCGGGTTACAAGAAGAAGCTTAACAAGCTTTGTCCTTTGAGTGTAGACCAGAACGTGACGGGAGAT
CTAGACGCAACGCCACAGGTTTTTGATAATCAGTACTTCAAAGACTTGGTTTCAGGGAGAGGGTTTCTTAACTCGGACCAGACTCTGTACACGAACAGAGAGACGAGAGAGTATGTGAAG
ATGTTTAGTGAGGATCAAGGAGAGTTCTTTAGAGCATTTGAAGAAGGGATGGTGAAGATGGGTGATTTGCAATCTGGGAGACCTGGTGAGGTTAGGTTTAATTGTAGGGTTGTTAATAGA
AGGCCTATTCATGGATTGCTCGAGGCTTGA

Retrieve as FASTA