Entry information : TsPrx53 (Thhalv10014029m)
Entry ID 9771
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-24 (Christophe Dunand)
Peroxidase information: TsPrx53 (Thhalv10014029m)
Name (synonym) TsPrx53 (Thhalv10014029m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx53
start..stop
S start..stop
BrPrx53-1Aa_other 629 0 1..339 1..338
AruPrx53-1 600 0 1..339 1..336
AruPrx53-2 599 0 1..339 1..336
CrubPrx120 595 0 1..339 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2064259..2064501 243 N° 2 2063963..2064154 192 N° 3 2063704..2063869 166 N° 4 2063201..2063619 419
complement(join(2063201..2063619,2063704..2063869,2063963..2064154,2064259..2064 501))


exon

Literature and cross-references TsPrx53 (Thhalv10014029m)
DNA ref. Phytozome 12:   scaffold_2 (2064501..2063201)
Protein sequence: TsPrx53 (Thhalv10014029m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   35346.51 Transmb domain:   %s   i12-34o
PI (pH):   %s   5.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVKNPSITCNGFSIIIVLTTLVISSSLFWTSSAQLNATFYSRTCPNASAIVRSTIQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDDSGSIQSEKNAAPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVLLGRRDSLTANQAGANSSIPSPVESLANITSKFSAVGLNTNDLVALSGAHTFGRARCGVFSNRLINFSGSGNPDPTLNTTLLNSLQQICPQNGSGSGITNLDLSTPDAFDNNYFSNLQSNNGLLQSDQELFSTTGSATIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSSGEIRLDCKKVNGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAAAAAATCCGTCTATTACTTGTAATGGCTTCTCCATTATAATCGTCCTCACTACTCTTGTCATCTCTTCTTCATTGTTTTGGACATCATCTGCGCAGTTAAACGCAACGTTT
TACTCCAGGACGTGCCCTAACGCCTCTGCCATCGTACGCAGTACTATTCAGCAAGCTCTTCAATCCGACTCGAGAATCGGAGCCAGCCTTATCCGCCTTCATTTTCACGACTGTTTTGTT
AAT
GTATATAAATCTTTATGATCAATACAGCTCTTTTAACGTGAAAAGCCTAGTGATCATTTTCGCCTAAGCCACTATACTTTTTCTTTCTTATGTTTGTAAAAAAGGGTTGCGACGCGT
CGATCTTGCTTGACGATAGTGGAAGCATCCAAAGCGAGAAGAATGCTGCCCCGAATGCAAACTCGGCTAGAGGATTCAACGTTGTCGATAATATCAAGACTGCCCTTGAGAACGCTTGCC
CCGGCGTTGTTTCTTGCTCTGATGTTTTAGCTCTTGCCTCAGAGGCCTCGGTTTCTTTG
GTAATAATACTTTCTTAATAAGACATATCAAACAGTACATATGTTAACTGTTCACATTCAT
CTATCTGACTTTACATGTTTGATCATCTTTAGGCAGGAGGGCCTTCATGGACTGTATTATTAGGCAGAAGAGATAGTCTCACAGCAAACCAGGCCGGGGCAAATTCGTCCATTCCTTCTC
CCGTCGAAAGCCTTGCCAACATCACATCTAAATTTTCAGCTGTCGGGCTAAATACCAACGATCTTGTAGCCTTATCTG
GTAAAAATCATCTACGTTAACTTATGGATCAAGTCAAAACCA
AACCCTAATACCATCTCTTGTGAATTTCTTTTATCTACGTAGGTGCACATACGTTCGGACGTGCTCGATGCGGAGTGTTCAGTAACAGACTAATCAACTTTAGCGGGTCGGGAAATCCTG
ACCCGACTCTAAACACGACGCTTCTCAACAGTCTTCAACAGATATGTCCTCAAAACGGCAGCGGATCGGGGATCACCAATCTCGATCTGAGCACACCTGATGCATTCGATAACAATTACT
TTTCCAACCTTCAGAGCAACAATGGGCTTCTTCAGTCAGACCAAGAACTGTTTTCTACCACAGGCTCAGCCACAATCGCGATTGTTACTTCTTTCGCAAGTAACCAGACTCTGTTTTTTC
AGGCATTTGCTCAGTCCATGATCAACATGGGGAATATAAGTCCCTTGACAGGGAGTAGTGGAGAGATTAGATTAGACTGTAAGAAGGTTAATGGAAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAAAAAATCCGTCTATTACTTGTAATGGCTTCTCCATTATAATCGTCCTCACTACTCTTGTCATCTCTTCTTCATTGTTTTGGACATCATCTGCGCAGTTAAACGCAACGTTT
TACTCCAGGACGTGCCCTAACGCCTCTGCCATCGTACGCAGTACTATTCAGCAAGCTCTTCAATCCGACTCGAGAATCGGAGCCAGCCTTATCCGCCTTCATTTTCACGACTGTTTTGTT
AAT
GGTTGCGACGCGTCGATCTTGCTTGACGATAGTGGAAGCATCCAAAGCGAGAAGAATGCTGCCCCGAATGCAAACTCGGCTAGAGGATTCAACGTTGTCGATAATATCAAGACTGCC
CTTGAGAACGCTTGCCCCGGCGTTGTTTCTTGCTCTGATGTTTTAGCTCTTGCCTCAGAGGCCTCGGTTTCTTTG
GCAGGAGGGCCTTCATGGACTGTATTATTAGGCAGAAGAGATAGT
CTCACAGCAAACCAGGCCGGGGCAAATTCGTCCATTCCTTCTCCCGTCGAAAGCCTTGCCAACATCACATCTAAATTTTCAGCTGTCGGGCTAAATACCAACGATCTTGTAGCCTTATCT
G
GTGCACATACGTTCGGACGTGCTCGATGCGGAGTGTTCAGTAACAGACTAATCAACTTTAGCGGGTCGGGAAATCCTGACCCGACTCTAAACACGACGCTTCTCAACAGTCTTCAACAG
ATATGTCCTCAAAACGGCAGCGGATCGGGGATCACCAATCTCGATCTGAGCACACCTGATGCATTCGATAACAATTACTTTTCCAACCTTCAGAGCAACAATGGGCTTCTTCAGTCAGAC
CAAGAACTGTTTTCTACCACAGGCTCAGCCACAATCGCGATTGTTACTTCTTTCGCAAGTAACCAGACTCTGTTTTTTCAGGCATTTGCTCAGTCCATGATCAACATGGGGAATATAAGT
CCCTTGACAGGGAGTAGTGGAGAGATTAGATTAGACTGTAAGAAGGTTAATGGAAGTTAA

Retrieve as FASTA