Entry information : TsPrx58-1 (Thhalv10014083m / ThPrx58-1)
Entry ID 9774
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-26 (Christophe Dunand)
Peroxidase information: TsPrx58-1 (Thhalv10014083m / ThPrx58-1)
Name (synonym) TsPrx58-1 (Thhalv10014083m / ThPrx58-1)
Class Class III peroxidase    [Orthogroup: Prx081]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx58-1
start..stop
S start..stop
BrPrx58-1Aa_other 630 0 1..330 1..330
AlyPrx58 619 0 1..330 1..329
AtPrx58 610 0 1..330 1..329
AhalPrx63 601 0 16..330 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6864163..6864375 213 N° 2 6863454..6863651 198 N° 3 6863146..6863311 166 N° 4 6862647..6863062 416
complement(join(6862647..6863062,6863146..6863311,6863454..6863651,6864163..6864 375))


exon

Literature and cross-references TsPrx58-1 (Thhalv10014083m / ThPrx58-1)
DNA ref. Phytozome 12:   scaffold_2 (6864375..6862647)
Protein sequence: TsPrx58-1 (Thhalv10014083m / ThPrx58-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (306)
PWM (Da):   %s   35521.74 (32891.3)  
PI (pH):   %s   4.79 (4.79) Peptide Signal:   %s   cut: 25 range:25-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSNIIPSLFLSILMFGLLGNNAQLSSDFYSTTCPNVTVIARGLIEQASRGDVRLTAKVMRLHFHDCFVNGCDGSVLLDAAPADGVEGEKEAFQNANSLDGFQVIDDIKTALENVCPGIVSCADILAIAAEISVALAGGPSWDVLLGRRDGRTANRADAVAALPLGPDSLDVLTSKFSVHNLDTTDLVALSGAHTFGRVQCGVITNRLHNFSGNNGQSDPSIEPEFLQTLRRQCPQGGSVTARVNLDPTSPDSFDNDYFKNLQNNRGVIESDQILFSSTGAPTVSLVNRFAEDQSEFFRNFARSMIKMGNVRTLTGTEGEIRRDCRRVN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTAAGCAATATTATTCCCTCGCTTTTTCTCTCGATTTTGATGTTTGGGCTTTTGGGCAATAATGCTCAACTTAGCTCTGATTTTTACTCCACGACGTGTCCTAATGTCACAGTC
ATCGCTCGGGGTCTGATCGAGCAAGCTAGCCGTGGCGACGTCAGACTCACTGCTAAAGTCATGCGTCTTCACTTTCACGACTGCTTCGTGAAC
GTAAGATCTATTTCTATTCATTAACAT
ATATAATAACGAAACCGATCGTTTAAATCCGCATGTGATATATCACATGATTGATGTTGAACAAACCAGCAGAACATGTTACATGTAAAAGTTTATATTTAATTAGGTCGGATTTTTTTT
TTAATGGATATAAATAGTTCATACTCATTGATTGACCAAAAATAAAAAAACCCACTCGTTGTAAAGGGTGATGGACAAGAGTTTATTTAGTGGAGTCACCAAATTTTGGTTTTAGATCAA
ACTTAACGGTTCTATTATATTTGACTACATATTCCTTCATATTAAGATAATAACGGTCATTCGAAAACCCAAAGTAAGATATGCCTTTTTTTAATTCACCTTCTCTAATAATTGACTTAG
AAAAGTACAGGCATCGACTCTGACTAGGAAAAAAATCTTAGGTTTATCTTATTAATGTAAATAGGTTTATCGTTAAAAATACATTATGCATAAAACATTTGTAGTCAAATTGTGTAAAAC
ATAGGGGTGTGATGGTTCGGTACTATTGGACGCTGCTCCTGCGGATGGAGTAGAGGGTGAAAAGGAAGCTTTCCAAAACGCTAATTCTCTTGACGGATTCCAAGTGATCGATGATATCAA
AACCGCCCTCGAGAACGTTTGCCCTGGAATTGTCTCTTGTGCCGATATCCTTGCTATCGCAGCTGAAATCTCTGTCGCACTG
GTAATAATCATATAATTCTCAACATTTAACCTCTAGGC
TACATGTCCTACTTTCTTACACTCTATTTTAAAAAAAAAATCTATAAAAAGAATTAAATATAACCATAAGTTAATATTTAATTATTTATATCAAATATAATTAGGCGGGAGGGCCGTCAT
GGGACGTATTGTTAGGAAGGAGAGATGGCCGGACGGCGAACCGTGCGGATGCGGTGGCTGCACTTCCACTAGGACCTGACTCTCTCGATGTTCTCACTTCTAAATTCTCCGTACATAATC
TTGACACTACCGATCTCGTCGCTCTATCTG
GTAATGTACTTTTCGCATCTTAATTCAATAGTACTTTGTTACAATATATCTTTAACGAATTATAAATAATAATACATGTACAGGTGCTCA
TACCTTCGGGAGGGTTCAGTGTGGAGTGATAACCAATCGTCTACACAATTTTAGTGGTAACAATGGACAGTCCGACCCGAGTATTGAACCGGAATTTTTGCAAACGTTGCGACGACAATG
CCCGCAAGGCGGAAGTGTCACCGCGAGGGTCAATCTTGATCCTACGAGTCCGGACTCATTTGACAACGACTATTTCAAGAACCTTCAAAACAACCGTGGAGTCATTGAATCAGATCAAAT
CTTGTTTTCTTCGACAGGAGCGCCTACTGTGTCTTTGGTGAATCGTTTTGCAGAGGACCAAAGTGAGTTCTTTAGGAATTTTGCGAGATCTATGATCAAGATGGGAAATGTAAGGACTCT
CACAGGAACTGAAGGAGAGATTCGTAGAGACTGCAGACGGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTAAGCAATATTATTCCCTCGCTTTTTCTCTCGATTTTGATGTTTGGGCTTTTGGGCAATAATGCTCAACTTAGCTCTGATTTTTACTCCACGACGTGTCCTAATGTCACAGTC
ATCGCTCGGGGTCTGATCGAGCAAGCTAGCCGTGGCGACGTCAGACTCACTGCTAAAGTCATGCGTCTTCACTTTCACGACTGCTTCGTGAAC
GGGTGTGATGGTTCGGTACTATTGGAC
GCTGCTCCTGCGGATGGAGTAGAGGGTGAAAAGGAAGCTTTCCAAAACGCTAATTCTCTTGACGGATTCCAAGTGATCGATGATATCAAAACCGCCCTCGAGAACGTTTGCCCTGGAATT
GTCTCTTGTGCCGATATCCTTGCTATCGCAGCTGAAATCTCTGTCGCACTG
GCGGGAGGGCCGTCATGGGACGTATTGTTAGGAAGGAGAGATGGCCGGACGGCGAACCGTGCGGATGCG
GTGGCTGCACTTCCACTAGGACCTGACTCTCTCGATGTTCTCACTTCTAAATTCTCCGTACATAATCTTGACACTACCGATCTCGTCGCTCTATCTG
GTGCTCATACCTTCGGGAGGGTT
CAGTGTGGAGTGATAACCAATCGTCTACACAATTTTAGTGGTAACAATGGACAGTCCGACCCGAGTATTGAACCGGAATTTTTGCAAACGTTGCGACGACAATGCCCGCAAGGCGGAAGT
GTCACCGCGAGGGTCAATCTTGATCCTACGAGTCCGGACTCATTTGACAACGACTATTTCAAGAACCTTCAAAACAACCGTGGAGTCATTGAATCAGATCAAATCTTGTTTTCTTCGACA
GGAGCGCCTACTGTGTCTTTGGTGAATCGTTTTGCAGAGGACCAAAGTGAGTTCTTTAGGAATTTTGCGAGATCTATGATCAAGATGGGAAATGTAAGGACTCTCACAGGAACTGAAGGA
GAGATTCGTAGAGACTGCAGACGGGTCAATTAA

Retrieve as FASTA