Entry information : TsPrx49-1 (Thhalv10000286m / ThPrx49-1)
Entry ID 9781
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2015-11-19 (Christophe Dunand)
Peroxidase information: TsPrx49-1 (Thhalv10000286m / ThPrx49-1)
Name (synonym) TsPrx49-1 (Thhalv10000286m / ThPrx49-1)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx49-1
start..stop
S start..stop
BrPrx49-2Aa_other 541 0 1..274 1..274
BrPrx49-1Aa_other 520 0 2..274 6..281
AalpPrx09 515 0 1..274 1..274
AhalPrx32 503 0 1..274 1..274
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2882344..2882568 225 N° 2 2882070..2882261 192 N° 3 2881826..2881991 166 N° 4 2881490..2881734 245
complement(join(2881490..2881734,2881826..2881991,2882070..2882261,2882344..2882 568))


exon

Literature and cross-references TsPrx49-1 (Thhalv10000286m / ThPrx49-1)
DNA ref. Phytozome 12:   scaffold_15 (2882568..2881490)
Protein sequence: TsPrx49-1 (Thhalv10000286m / ThPrx49-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   275 (253)
PWM (Da):   %s   29777.9 (27369.6)  
PI (pH):   %s   8.87 (9.12) Peptide Signal:   %s   cut: 23 range:23-275
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVSSFLFVLSLLCVLPLCLCDKSYGGKLNPWFYAHSCPKAGEIVRSVVANAVARETRMAASLMRLHFHDCFVQGCDGSLLLDSSGRIVSEKSSNPNSKSARGFEVVDQIKAQLEKECPGTVSCADILTLAARDSSVLTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQNLSVLDIVSAARFDNSYFKNLIEKMGLLNSDV

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing which was not found yet). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAGTCAGTAGCTTTCTCTTTGTTCTTTCTCTCCTTTGCGTTCTCCCTCTTTGTCTCTGCGATAAGAGCTATGGAGGCAAACTAAACCCGTGGTTTTACGCCCATTCATGCCCG
AAAGCCGGAGAGATCGTGAGATCAGTTGTAGCCAACGCTGTAGCTAGAGAGACCCGTATGGCTGCTTCCTTGATGAGACTTCATTTCCACGACTGTTTCGTTCAG
GTTTGGTTAATTTAT
TCGACGATCATCATTTTTTTGTTTATTAAGTTAGTTGCTTATTGAACAAGGTAACTGCGAAATGCAGGGTTGTGATGGCTCTTTGCTTCTAGACAGCAGTGGGAGGATAGTGAGTGAGAA
AAGCTCGAACCCTAACAGCAAATCTGCTCGTGGATTTGAAGTAGTTGACCAGATCAAAGCTCAGTTGGAGAAAGAATGCCCTGGAACGGTCTCTTGCGCTGATATTCTCACCCTAGCCGC
TAGAGACTCCTCTGTTCTT
GTAAGTCTCCTCCACAATATCTGTTTTCTCGAGCAAAATTTTGAAAAATCAACTGATTCGGTTTGGATTTTGGTTTAGACTGGTGGACCAAGCTGGATGGT
CCCATTGGGAAGAAGGGATTCAAGAAGTGCAAGCTTGAGTGGTTCGAACAACAACATCCCTGCACCAAACAACACTTTCCAGACAATTCTCTCAAAGTTCAATCGTCAAGGACTTGATGT
CACCGACCTTGTCGCTCTCTCTG
GTAAGCTTCTTTCATTCTATCACAGTTGCTTTACATGCACGGTACAAAATCAAAGAAACCCTCGTACCTTACTTTCTTAACTATTTCTCAGGGAGTC
ACACCATTGGATTCTCAAGATGCACGAGTTTCAGACAGAGGCTGTACAATCAGTCCGGAAACGGTCGTCCAGACATGACATTGGAACAATCCTTCGCTGCTAACTTGCGCCAAAGGTGTC
CTAGATCTGGAGGGGACCAGAATCTCTCGGTGCTGGACATTGTCAGCGCGGCGAGGTTCGACAACAGCTATTTCAAGAACTTGATAGAGAAAATGGGGTTGTTGAACTCGGACGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAGTCAGTAGCTTTCTCTTTGTTCTTTCTCTCCTTTGCGTTCTCCCTCTTTGTCTCTGCGATAAGAGCTATGGAGGCAAACTAAACCCGTGGTTTTACGCCCATTCATGCCCG
AAAGCCGGAGAGATCGTGAGATCAGTTGTAGCCAACGCTGTAGCTAGAGAGACCCGTATGGCTGCTTCCTTGATGAGACTTCATTTCCACGACTGTTTCGTTCAG
GGTTGTGATGGCTCT
TTGCTTCTAGACAGCAGTGGGAGGATAGTGAGTGAGAAAAGCTCGAACCCTAACAGCAAATCTGCTCGTGGATTTGAAGTAGTTGACCAGATCAAAGCTCAGTTGGAGAAAGAATGCCCT
GGAACGGTCTCTTGCGCTGATATTCTCACCCTAGCCGCTAGAGACTCCTCTGTTCTT
ACTGGTGGACCAAGCTGGATGGTCCCATTGGGAAGAAGGGATTCAAGAAGTGCAAGCTTGAGT
GGTTCGAACAACAACATCCCTGCACCAAACAACACTTTCCAGACAATTCTCTCAAAGTTCAATCGTCAAGGACTTGATGTCACCGACCTTGTCGCTCTCTCTG
GGAGTCACACCATTGGA
TTCTCAAGATGCACGAGTTTCAGACAGAGGCTGTACAATCAGTCCGGAAACGGTCGTCCAGACATGACATTGGAACAATCCTTCGCTGCTAACTTGCGCCAAAGGTGTCCTAGATCTGGA
GGGGACCAGAATCTCTCGGTGCTGGACATTGTCAGCGCGGCGAGGTTCGACAACAGCTATTTCAAGAACTTGATAGAGAAAATGGGGTTGTTGAACTCGGACGTGTAA

Retrieve as FASTA