Entry information : TsPrx58-2 (Thhalv10016025m / ThPrx58-2)
Entry ID 9782
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-21 (Christophe Dunand)
Peroxidase information: TsPrx58-2 (Thhalv10016025m / ThPrx58-2)
Name (synonym) TsPrx58-2 (Thhalv10016025m / ThPrx58-2)
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx58-2
start..stop
S start..stop
AlyPrx58 578 0 1..329 1..329
TsPrx58-1 573 0 1..329 1..330
AhalPrx63 567 0 16..329 1..314
AtPrx58 567 0 1..329 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6860672..6860881 210 N° 2 6860156..6860353 198 N° 3 6859779..6859944 166 N° 4 6859193..6859608 416
complement(join(6859193..6859608,6859779..6859944,6860156..6860353,6860672..6860 881))


exon

Literature and cross-references TsPrx58-2 (Thhalv10016025m / ThPrx58-2)
DNA ref. Phytozome 12:   scaffold_2 (6860881..6859193)
Protein sequence: TsPrx58-2 (Thhalv10016025m / ThPrx58-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (308)
PWM (Da):   %s   35389.89 (33050.7)  
PI (pH):   %s   7.68 (7.73) Peptide Signal:   %s   cut: 22 range:22-329
Sequence 371
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCLSNTVSSLLLSILMYGVLSNAQLSSQFYSKTCPNVTVIARGVIQRASRVDVRLTAKVTRLHFHDCFVNGCDGSVLLDASPAGGVESEKGAFQNAGSLDGFEVIDDIKTAIENVCPGVVSCADILAIAAEISVSLAGGPSWDVLLGRRDGRTASRADAAAALPLAFDSLDVLSSKFSALNLDTTDLVALSGAHTFGRVQCIVMNNRLHNFSGNNGQSDPSIEPELLQTLRRQCPQGGNLTTRVNIDHTSPDSFDNDYFKNLQNNRGVIETDQILFSSTGAPTVSLVNRFAKSQRKFFRAFAKSMIKMGNARTLTGSEGEIRRDCRRVN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGTCTAAGCAATACTGTATCCTCACTTTTGCTCTCCATTTTGATGTATGGAGTTTTGAGTAATGCTCAACTTAGCTCTCAGTTTTACTCCAAGACGTGCCCTAACGTCACAGTCATC
GCTCGGGGTGTAATCCAGCGAGCTAGCCGTGTCGACGTCAGACTTACTGCCAAAGTCACCCGTCTTCACTTTCACGACTGTTTCGTGAAC
GTAAGATCGATCTACTTCTATTCATTAGCA
TATATATAAATAGATACGTATATGTTTATGATTTTTATTTTTGGTTAACAATGAATGAAACCTGTCGTTTTAATCTGCATGTGATCACAACTAGCATTCGACTATATATTCCGTCAATAA
CCTTGGTCTCATACTGAGAATTTTAGATACTAACGGTCTTTTAAAACCTTTTTTAAAAATATGCATGCCTTTTTGGTTCTTATCTAATCATTAAATAAGAAACGTATAGGTGGCATAGAA
TTTAATTTTGTCAAGAAAACATTGACCTCAAAGTGTGTGAACACACAGGGGTGTGATGGTTCGGTTCTATTGGATGCATCTCCTGCGGGTGGAGTGGAGAGTGAAAAGGGAGCTTTCCAA
AACGCTGGTTCTCTTGACGGATTCGAAGTGATCGATGATATCAAAACCGCCATCGAGAACGTTTGTCCTGGAGTTGTCTCTTGTGCCGATATTCTCGCTATCGCAGCTGAAATCTCTGTC
TCATTG
GTTAGTAAGATGATTCTTGAAATTTTAGTGCTTTTCAGATCCCTTTTTTTATATATTTTATATCAGCAACATGCATCGTGCATGTTTAATGAAAAAATAATAACACTACTACGT
ACAAACCACTAAATTTCTATGTCATGATCTCATATACTGATTTGTTTTAGTCTACGAAACATTGTGATATAATTAATTGAATAATTATATCATTTAGGCGGGAGGGCCATCATGGGACGT
ATTGTTAGGAAGGAGAGATGGTCGGACGGCGAGCCGTGCGGATGCGGCGGCTGCTCTTCCACTAGCATTTGACTCTCTCGATGTTCTCTCTTCTAAATTCTCCGCACTTAATCTTGACAC
TACCGATCTCGTGGCTTTATCCG
GTAATAATCTTTCGCATCTTAACTCTTTTTTTTTTCGGTTTCTTATAAAAAAAAAATTCATTGGTCATCTTGAAGAAGTATCATAAAACTTTATACC
AAGGGGCCCTCAATATATCTAGTACTTTGCTACAACATATCTAAACGGATTATGAATCATAATACATGTACAGGTGCTCATACCTTCGGGAGAGTTCAGTGTATAGTGATGAACAATCGT
CTACACAACTTTAGTGGTAACAATGGACAGTCCGACCCGAGTATTGAACCGGAATTATTGCAAACGTTGCGACGACAATGCCCGCAAGGTGGAAATCTCACCACGAGGGTCAATATTGAT
CATACGAGTCCTGACTCATTCGACAACGACTATTTCAAGAACCTTCAAAACAACCGCGGAGTCATTGAAACAGATCAAATCTTGTTCTCTTCGACAGGAGCGCCTACTGTGTCTTTGGTG
AATCGTTTTGCAAAGAGCCAACGTAAGTTCTTTAGAGCTTTTGCTAAATCAATGATCAAAATGGGAAATGCAAGGACTCTCACAGGATCTGAAGGAGAGATTCGTAGAGACTGCAGACGG
GTTAATTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGTCTAAGCAATACTGTATCCTCACTTTTGCTCTCCATTTTGATGTATGGAGTTTTGAGTAATGCTCAACTTAGCTCTCAGTTTTACTCCAAGACGTGCCCTAACGTCACAGTCATC
GCTCGGGGTGTAATCCAGCGAGCTAGCCGTGTCGACGTCAGACTTACTGCCAAAGTCACCCGTCTTCACTTTCACGACTGTTTCGTGAAC
GGGTGTGATGGTTCGGTTCTATTGGATGCA
TCTCCTGCGGGTGGAGTGGAGAGTGAAAAGGGAGCTTTCCAAAACGCTGGTTCTCTTGACGGATTCGAAGTGATCGATGATATCAAAACCGCCATCGAGAACGTTTGTCCTGGAGTTGTC
TCTTGTGCCGATATTCTCGCTATCGCAGCTGAAATCTCTGTCTCATTG
GCGGGAGGGCCATCATGGGACGTATTGTTAGGAAGGAGAGATGGTCGGACGGCGAGCCGTGCGGATGCGGCG
GCTGCTCTTCCACTAGCATTTGACTCTCTCGATGTTCTCTCTTCTAAATTCTCCGCACTTAATCTTGACACTACCGATCTCGTGGCTTTATCCG
GTGCTCATACCTTCGGGAGAGTTCAG
TGTATAGTGATGAACAATCGTCTACACAACTTTAGTGGTAACAATGGACAGTCCGACCCGAGTATTGAACCGGAATTATTGCAAACGTTGCGACGACAATGCCCGCAAGGTGGAAATCTC
ACCACGAGGGTCAATATTGATCATACGAGTCCTGACTCATTCGACAACGACTATTTCAAGAACCTTCAAAACAACCGCGGAGTCATTGAAACAGATCAAATCTTGTTCTCTTCGACAGGA
GCGCCTACTGTGTCTTTGGTGAATCGTTTTGCAAAGAGCCAACGTAAGTTCTTTAGAGCTTTTGCTAAATCAATGATCAAAATGGGAAATGCAAGGACTCTCACAGGATCTGAAGGAGAG
ATTCGTAGAGACTGCAGACGGGTTAATTA

Retrieve as FASTA