Entry information : TsPrx20 ( Thhalv10016900m)
Entry ID 9786
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: TsPrx20 ( Thhalv10016900m)
Name (synonym) TsPrx20 ( Thhalv10016900m)
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx20
start..stop
S start..stop
NoffPrx20-1A 646 0 1..336 1..337
AhalPrx14 644 0 1..337 1..337
AlyPrx20 640 0 1..336 1..336
BrPrx20-1Aa_other 638 0 7..337 4..334
Gene structure Fichier Exons


exon

Literature and cross-references TsPrx20 ( Thhalv10016900m)
DNA ref. Phytozome 12:   scaffold_10 (8173388..8174604)
Protein sequence: TsPrx20 ( Thhalv10016900m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (312)
PWM (Da):   %s   38073.55 (35333.9) Transmb domain:   %s   i7-29o143-162i
PI (pH):   %s   6.4 (5.43) Peptide Signal:   %s   cut: 25 range:25-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIKLKKLWVSLIVVSMITTSALGDFGGQLVKRFYKESCPLAEEIVKHNVEVAILRDPRMAASLLRLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNVNSLRGFEVIDYIKYLLEEACP
LTVSCSDIITIAARDSVFLRGGPWWEVLLGRRDSLKASFSGANQYIPAPNSSLDSLIVNFKQQGLDIQDLIALSGAHTIGKARCLSFKQRIAQPNMEQTFYVDEFKRHSTFRRILRSQCK
DSSRNNELSPLDLQTPAYFDNHYYINLLKGRGLLISDNVLVSEDHEGEIFKKVWEYAVDQDLFFQDFVESMLKMGNINVLTGIEGEIRENCRFVNV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
DNA
Send to BLAST
CDS
Send to BLAST