Entry information : TsPrx28 (Thhalv10021155m)
Entry ID 9798
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-12-24 (Christophe Dunand)
Peroxidase information: TsPrx28 (Thhalv10021155m)
Name (synonym) TsPrx28 (Thhalv10021155m)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx28
start..stop
S start..stop
BrPrx28-1Aa_other 578 0 1..320 1..323
AlyPrx28 519 0 1..320 1..321
AtPrx28 519 0 1..320 1..321
BstrPrx48 512 0 1..320 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8550550..8550753 204 N° 2 8551232..8551698 467 N° 3 8551801..8552092 292  
join(8550550..8550753,8551232..8551698,8551801..8552092)


exon

Literature and cross-references TsPrx28 (Thhalv10021155m)
DNA ref. Phytozome 12:   scaffold_13 (8550550..8552092)
Protein sequence: TsPrx28 (Thhalv10021155m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (299)
PWM (Da):   %s   34446.51 (32036.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   6.27 (5.37) Peptide Signal:   %s   cut: 22 range:22-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIGKIYVLLLVLYILPAALAQLRVGFYSQSCPNAETIIQNLVSERFGRDPSITAALTRMHFHDCFVQGCDASLLIDPTTANQEPEKIAGPNGSVRGFELIDEIKTALEAQCPSIVSCSDIVTLATRDSVFLGGGPSYVVPTGRRDGFVSNRIDAERILPGPGLAVPDMLTFFGNKGMNVFDAVALLGAHTVGFGSCGNFVDRLTNFQGTGQPDPSMDPGLAGRLRNTCSAGGSQFAALDQSTPFSFDNLFFTQIRERKGVLLLDQRLATDPATSGVVFQYAVNNELFKRQFAIAMVKMGAVDVLTGLAGEIRRNCRAFN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (introns 1 and 3'). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATTGGAAAGATTTATGTTCTTCTCCTAGTTTTATATATTTTACCCGCCGCATTAGCTCAGCTCAGGGTCGGGTTTTATAGCCAATCATGCCCTAATGCAGAGACTATCATACAG
AACTTGGTCAGCGAGCGGTTTGGTCGTGACCCTTCCATCACAGCCGCCTTGACTCGGATGCATTTTCACGACTGTTTTGTTCAG
GTATGAATCTCATCAAACGTCCTTTTTTTTTAGGTT
TTGATATGTTTCTATTTATCAGAAGATCATTTAATCAAAGAGAATTAGGTCAGAAATATTATTCGATCAAGTTATTCATTTTCTTTTTTGTTTAAGCTGAATAATTTTTGGTTTTAAGAA
ATCAACATACTGTAGTTTCATTAAACTAATTAATTTGACCGTTAAATACAAAAGGCATCAATACATTTTACAATAATTTTATACAGATAACCTGATTTAAGAATACAAAACTAAGTTTGA
AATCATATGTTTTACTTTTCTTCTGAAAAAAAAAACCCATAAAATTATAAATAATATAAGGCTATATCTGAGGCTTGACGTACGTACTTGAAAATGCATAAAATTTAACAATTTGTTATA
TGTGTAATAGTTCTGTTTTGACAATAATCTATGAAATATTATTCATAAGAACAATTATCGTTGGCGTTTCTTGATTAATTAGGGCTGCGACGCTTCTCTCCTCATAGACCCAACGACGGC
GAATCAAGAACCGGAAAAGATCGCCGGGCCAAACGGCAGCGTGAGAGGGTTCGAGCTGATAGACGAGATAAAGACGGCTCTCGAGGCTCAATGCCCCTCCATAGTCTCGTGCTCTGACAT
AGTCACGCTCGCCACACGTGACTCTGTCTTCTTAGGTGGAGGACCGAGCTACGTGGTCCCCACCGGACGACGTGATGGCTTTGTGTCAAACCGTATAGACGCCGAAAGGATCCTCCCCGG
ACCAGGCCTCGCCGTTCCAGATATGCTTACGTTCTTTGGGAATAAAGGGATGAACGTTTTCGATGCGGTGGCTCTTTTGGGTGCACACACCGTTGGGTTCGGTTCTTGTGGTAATTTTGT
GGACCGGCTCACTAATTTCCAAGGAACCGGACAGCCCGACCCCTCTATGGACCCCGGTTTGGCTGGCAG
GTACATATACATATATTTTAGTTTTACGGAATCATGAAGAAAAAATATTAT
TTCATATACATCTATATTAATGGTTCCCTTGAATATTCCTTATAATAATAGGCTAAGGAACACATGTTCGGCTGGAGGCAGCCAATTTGCGGCACTGGACCAGTCGACGCCATTCTCATT
CGACAACTTATTCTTCACTCAGATCAGAGAAAGGAAAGGAGTCTTGCTACTTGACCAGCGGCTTGCGACCGACCCTGCCACTTCTGGTGTTGTGTTTCAATACGCGGTCAACAACGAACT
ATTCAAACGTCAGTTCGCAATTGCAATGGTGAAGATGGGAGCCGTTGACGTGCTGACCGGTTTAGCCGGTGAGATCAGGAGGAATTGTAGAGCATTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATTGGAAAGATTTATGTTCTTCTCCTAGTTTTATATATTTTACCCGCCGCATTAGCTCAGCTCAGGGTCGGGTTTTATAGCCAATCATGCCCTAATGCAGAGACTATCATACAG
AACTTGGTCAGCGAGCGGTTTGGTCGTGACCCTTCCATCACAGCCGCCTTGACTCGGATGCATTTTCACGACTGTTTTGTTCAG
GGCTGCGACGCTTCTCTCCTCATAGACCCAACGACG
GCGAATCAAGAACCGGAAAAGATCGCCGGGCCAAACGGCAGCGTGAGAGGGTTCGAGCTGATAGACGAGATAAAGACGGCTCTCGAGGCTCAATGCCCCTCCATAGTCTCGTGCTCTGAC
ATAGTCACGCTCGCCACACGTGACTCTGTCTTCTTAGGTGGAGGACCGAGCTACGTGGTCCCCACCGGACGACGTGATGGCTTTGTGTCAAACCGTATAGACGCCGAAAGGATCCTCCCC
GGACCAGGCCTCGCCGTTCCAGATATGCTTACGTTCTTTGGGAATAAAGGGATGAACGTTTTCGATGCGGTGGCTCTTTTGGGTGCACACACCGTTGGGTTCGGTTCTTGTGGTAATTTT
GTGGACCGGCTCACTAATTTCCAAGGAACCGGACAGCCCGACCCCTCTATGGACCCCGGTTTGGCTGGCAG
GCTAAGGAACACATGTTCGGCTGGAGGCAGCCAATTTGCGGCACTGGAC
CAGTCGACGCCATTCTCATTCGACAACTTATTCTTCACTCAGATCAGAGAAAGGAAAGGAGTCTTGCTACTTGACCAGCGGCTTGCGACCGACCCTGCCACTTCTGGTGTTGTGTTTCAA
TACGCGGTCAACAACGAACTATTCAAACGTCAGTTCGCAATTGCAATGGTGAAGATGGGAGCCGTTGACGTGCTGACCGGTTTAGCCGGTGAGATCAGGAGGAATTGTAGAGCATTCAAC
TAA

Retrieve as FASTA