Entry information : AtPrx17(At2g22420 / PER17 / AtperoxP17 / Atp25a / AtP25)
Entry ID 98
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-03-04 (Christophe Dunand)
Peroxidase information: AtPrx17(At2g22420 / PER17 / AtperoxP17 / Atp25a / AtP25)
Name AtPrx17(At2g22420 / PER17 / AtperoxP17 / Atp25a / AtP25)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Siliques
Stamen Abscission Zone
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx17
start..stop
S start..stop
AhalPrx10 660 0 1..329 1..329
AlyPrx17 659 0 1..329 1..329
NoffPrx17-1A 609 0 16..329 15..328
CrubPrx17-1A 608 0 1..329 1..332
Gene structure Fichier Exons


exon

Literature and cross-references AtPrx17(At2g22420 / PER17 / AtperoxP17 / Atp25a / AtP25)
Literature REFERENCE 1 Cai S, Lashbrook CC. Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2. Plant Physiol. 2008 Mar;146(3):1305-21
REFERENCE 2 Cosio C, Ranocha P, Francoz E, Burlat V, Zheng Y, Perry SE, Ripoll JJ, Yanofsky M, Dunand C. The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation. New Phytol. 2017 Jan;213(1):250-263.
Protein ref. UniProtKB:   Q9SJZ2
DNA ref. Phytozome 12:   Chr2 (9513341..9514484)
mRNA ref. GenBank:   NM_127806
Cluster/Prediction ref. Phytozome Gene 12:   19642479  19642479 UniGene:   At.24416
Omic ref. AtProteome:   At2g22420 ATTED-II:   At2g22420 e-FP Browser:   At2g22420 ePlant:   At2g22420 Genevestigator:   At2g22420 RnR:   At2g22420 TAIR:   At2g22420
Protein sequence: AtPrx17(At2g22420 / PER17 / AtperoxP17 / Atp25a / AtP25)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (309)
PWM (Da):   %s   36559.37 (34382.1) Transmb domain:   %s   o714-736i1166-1188o1203-1225i1256-1278o1309-1331i1338-1360o
PI (pH):   %s   4.82 (4.75) Peptide Signal:   %s   cut: 21 range:21-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLLPHLILYLTLLTVVVTGETLRPRFYSETCPEAESIVRREMKK
AMIKEARSVASVMRFQFHDCFVN
GCDASLLLDDTPNMLGEKLSLSNIDSLRSFEVVDDIKEALEKACPATVSCADIVIMAARDAVALTGGPDWEVKLGRKDSLTASQQDSDDIMPSPRANATFLIDLFERFNLSVKDMVALSG
SHSIGQGRCFSIMFRLYNQSGSGKPDPALEPSYRKKLDKLCPLGGDENVTGDLDATPQVFDNQYFKDLVSGRGFLNSDQTLYTNLVTREYVKMFSEDQDEFFRAFAEGMVKLGDLQSGRP
GEIRFNCRVVNRRPIDVLLVS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2), 5 cDNA and 3 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST