Entry information : TsAPx07 (Thhalv10028741m)
Entry ID 9809
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsAPx07 (Thhalv10028741m)
Name (synonym) TsAPx07 (Thhalv10028741m)
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsAPx07
start..stop
S start..stop
BstrAPx07 633 0 1..347 1..348
AtAPx07 627 0 1..347 1..349
CrubAPx07 612 0 1..347 1..344
CagraAPx07 605 0 1..347 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11333075..11333164 90 N° 2 11333248..11333352 105 N° 3 11333492..11333576 85 N° 4 11333663..11333763 101
N° 5 11333840..11333880 41 N° 6 11333961..11334091 131 N° 7 11334179..11334285 107 N° 8 11334358..11334495 138
N° 9 11334571..11334705 135 N° 10 11334786..11334896 111  
join(11333075..11333164,11333248..11333352,11333492..11333576,11333663..11333763 ,11333840..11333880,11333961..11334091,11334179..11334285,11334358..11334495,113 34571..11334705,11334786..11334896)


exon

Literature and cross-references TsAPx07 (Thhalv10028741m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 12:   scaffold_3 (11333075..11334896)
EST ref. GenBank:   BAJ33725
Protein sequence: TsAPx07 (Thhalv10028741m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348
PWM (Da):   %s   37741.64  
PI (pH):   %s   9.57
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGVSFLSTVPSFTNTNNLQHLTLSSSHRSGLIIRCCKIDPQVSGECLAFHRRDVLKLAGTAIGMLIGKGFINHVGDAKAADLNQRRQRSDFQSKIKLMLSKAVKAKPELVPSILTLALNDAMTYDKATKSGGANGSIRFSSEISRAENAGLSDGLALIEEAKKEIDSFSKGGPISYADLIQLAGQAAVKSTFLASAIRKCGGNEEKGNLLYTAYGSSGQWALFDRQFGRSDATEADPEGRIPLWRKATVQEMKDKFIAIGLGPRQLAVMSAFLGPDQAATEQLLASDPQVAPWVQKYQRSRETVSQTDYEVDLITALTKLSGLGQQINYEAYTYPVERINLSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Incorrect prediction from phytozome (extra 5' end has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGAGTTTCTTTCCTCTCCACTGTTCCTTCCTTCACCAACACAAACAATCTTCAACATCTCACACTCTCTTCTTCTCATCGCTCTGTGAGTTTCTACCATTTCACATTCTTTGCC
TCTTCATTTCTTCTAACCCATTTACACTCTTATGCTAATATGATGATCATCAGGGTCTCATCATTCGATGTTGCAAGATCGATCCCCAAGTTTCCGGCGAATGTTTAGCTTTCCACCGCC
GGGATGTTTTAAAACTCGCCGGCACCGCCATTGGAATG
GTACCTTAATCTTCAATTTTACAGGATTCTTGCTCTGAATCTTGATGTCTTTGTGTCACAATTTGCTTCAGAAATAGTTGAA
CTGTGGGTATATTGTGATTGATGAGTCCTTGGCAGTGATGATCTCTCTTCTTAGGAGTTAATAGGTAAGGGCTTCATTAACCATGTGGGTGATGCAAAAGCTGCTGATTTGAATCAGCGT
AGACAAAGATCCGACTTTCAAT
GTGAGTTCTCAAACAGATTCATGTAAAACAAAAATGAAGTAGCAAGAGGCTGTTTTGACTCTAAAGGTTTCACTTTTATTATGCAGCAAAGATCAAGC
TTATGCTTTCGAAAGCGGTTAAGGCTAAACCGGAGCTTGTACCTTCCATACTTACTCTAGCTCTTAATGATGCCATGACTTATGACAAG
GTCAGGCTTCATAATTTATCTTATCCATCTC
TCTGGTGATTGCACAACTCTTGACAAATAGCATTAATTTGTGTAGGCTACAAAATCCGGGGGAGCCAATGGATCCATACGGTTCAGGTACTTCTTGCTCTTGAAACGTTCTCTGCATTAG
CTCAAATGGGAAATAACCTTAGGCTTAATCTTATCTTTATGTGTAGCTCTGAGATAAGCAGAGCAGAGAACGCAGGGCTTTCTGATGGGTTGGCTCTCATAGAAGAAGCAAAGAAGGAGA
TTGACTCTTTCTCTAAGGGTGGACCTATTTCATATGCAGATCTCATTCAATTAGCAG
GTGATGATTGATATATACCAAAGCTTGTTCATGAACAGAGCATCATCATTGTGAAACTTAAAA
GTCTTTCATGGTTATATTCTGTAGGACAAGCAGCGGTCAAGTCTACTTTTTTAGCATCGGCAATACGCAAATGCGGTGGAAATGAAGAGAAAGGGAACTTACTCTACACTGCATATGGTT
CAAGTGGTCAG
GTACACAATGCTACCTCACGTTTGAGTCGTCACACATTGTGTAAATGGAAACTGACTTTTGTGAATCTTTAGTGGGCTTTGTTTGATAGGCAATTCGGAAGGAGTGATG
CAACAGAGGCAGATCCAGAAGGGAGAATTCCACTTTGGAGAAAAGCAACTGTGCAAGAGATGAAAGATAAGTTCATTGCCATCGGATTAGGTCCTCGTCAG
GTACATTGGTTTTACCGGT
TCAAAAAAACGGTTTATTTGATCAACCAAATTTACTGCTAACCTGTGTATTTGTAGCTAGCTGTAATGTCTGCATTCTTGGGTCCTGATCAAGCCGCAACAGAACAGCTCTTAGCTAGCG
ACCCACAAGTCGCTCCATGGGTTCAGAAGTATCAACGAAGCCGTGAAACTGTATCTCAGACAGATTACGAG
GTTTGTGTTTTGCTAGATTTAGCTTTACCATATATTCTCCTCTGGTTTT
AAACTCATACTAGTCTTGAACATGTTTTCAGGTTGATTTGATAACTGCTTTGACAAAGCTGAGTGGTCTAGGACAGCAAATCAACTATGAGGCATACACATATCCTGTCGAGCGGATCAA
TCTAAGCAAACTCAAGCTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGGAGTTTCTTTCCTCTCCACTGTTCCTTCCTTCACCAACACAAACAATCTTCAACATCTCACACTCTCTTCTTCTCATCGCTCTGGTCTCATCATTCGATGTTGCAAGATCGAT
CCCCAAGTTTCCGGCGAATGTTTAGCTTTCCACCGCCGGGATGTTTTAAAACTCGCCGGCACCGCCATTGGAATG
TTAATAGGTAAGGGCTTCATTAACCATGTGGGTGATGCAAAAGCT
GCTGATTTGAATCAGCGTAGACAAAGATCCGACTTTCAAT
CAAAGATCAAGCTTATGCTTTCGAAAGCGGTTAAGGCTAAACCGGAGCTTGTACCTTCCATACTTACTCTAGCTCTTAAT
GATGCCATGACTTATGACAAG
GCTACAAAATCCGGGGGAGCCAATGGATCCATACGGTTCAGCTCTGAGATAAGCAGAGCAGAGAACGCAGGGCTTTCTGATGGGTTGGCTCTCATAGAA
GAAGCAAAGAAGGAGATTGACTCTTTCTCTAAGGGTGGACCTATTTCATATGCAGATCTCATTCAATTAGCAG
GACAAGCAGCGGTCAAGTCTACTTTTTTAGCATCGGCAATACGCAAA
TGCGGTGGAAATGAAGAGAAAGGGAACTTACTCTACACTGCATATGGTTCAAGTGGTCAG
TGGGCTTTGTTTGATAGGCAATTCGGAAGGAGTGATGCAACAGAGGCAGATCCAGAAGGG
AGAATTCCACTTTGGAGAAAAGCAACTGTGCAAGAGATGAAAGATAAGTTCATTGCCATCGGATTAGGTCCTCGTCAG
CTAGCTGTAATGTCTGCATTCTTGGGTCCTGATCAAGCCGCA
ACAGAACAGCTCTTAGCTAGCGACCCACAAGTCGCTCCATGGGTTCAGAAGTATCAACGAAGCCGTGAAACTGTATCTCAGACAGATTACGAG
GTTGATTTGATAACTGCTTTGACAAAG
CTGAGTGGTCTAGGACAGCAAATCAACTATGAGGCATACACATATCCTGTCGAGCGGATCAATCTAAGCAAACTCAAGCTATAA

Retrieve as FASTA