Entry information : TsPrx64-1 (Thhalv10027848m)
Entry ID 9810
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-07-27 (Christophe Dunand)
Peroxidase information: TsPrx64-1 (Thhalv10027848m)
Name (synonym) TsPrx64-1 (Thhalv10027848m)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx64-1
start..stop
S start..stop
BrPrx64_other 608 0 1..317 1..317
BstrPrx12 597 0 1..317 1..317
CrubPrx43 592 0 1..317 1..317
CagraPrx56 591 0 1..317 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1859660..1859863 204 N° 2 1859370..1859558 189 N° 3 1859108..1859270 163 N° 4 1858452..1858849 398
complement(join(1858452..1858849,1859108..1859270,1859370..1859558,1859660..1859 863))


exon

Literature and cross-references TsPrx64-1 (Thhalv10027848m)
DNA ref. Phytozome 12:   scaffold_14 (1859863..1858452)
Protein sequence: TsPrx64-1 (Thhalv10027848m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (295)
PWM (Da):   %s   34786.57 (32171.2)  
PI (pH):   %s   9.04 (9.22) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAHFPYLLLTVILSVSFNVEALSPHYYDQSCPQADHIVTNAVKKAMSNDKTVPAALLRMHFHDCFVRGCDASVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGVVSCADILSLAARDAVALSGGPTWEVPKGRKDGRISKAIETRQLPAPTFNISQLQQSFGQRGLSMHDLVVLSGGHTLGFAHCSSFQNRIHNFNLQKQVDPTLNPSFAASLNVICPAHNKVKNAGATMDATTTYFDNVYYKMLMQGQSLFSSDQALLTTPSSKKLVAKYASSMEEYERAFVKSIIKMSSISGNGKEVRHNCRRVR*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACATTTTCCCTATCTCCTTCTCACGGTCATCTTATCAGTTTCATTCAACGTTGAAGCACTCAGTCCTCACTACTACGACCAGTCATGTCCACAAGCCGACCACATTGTAACC
AATGCAGTCAAGAAAGCAATGTCGAACGACAAAACTGTCCCTGCTGCACTCTTGAGGATGCATTTTCACGACTGCTTTGTTAGG
GTATCTACTATTTACACACCACTTCCTTGTCATCAT
TCAATCTTATGTCTGCATATACTAATTAAAGAAATAATGTCGGTGAATATTTATGATGATTAAAGGGATGTGATGCGTCGGTGCTTTTAGACTCGAAGGGAAAGAACAAAGCCGAGAAAG
ATGGACCTCCTAACATCTCACTCCATGCGTTTTATGTGATTGACAATGCAAAGAAGGCATTAGAAGAGCAATGTCCCGGTGTTGTCTCTTGTGCAGATATCCTTTCACTCGCTGCAAGAG
ATGCAGTCGCTCTC
GTTAGTCCCGCACCATTTTATATATTCCAAATACTAATTTTATTTGATATGATTAAAATGAATGATTCTTCTACATACTATCTGTGAATATTATAATAGTCAGGAG
GGCCAACGTGGGAAGTTCCAAAAGGGAGAAAAGATGGAAGAATATCAAAGGCAATAGAAACAAGACAACTACCAGCTCCTACGTTCAACATATCTCAATTGCAACAAAGCTTTGGCCAAA
GAGGCCTCTCTATGCACGATCTTGTTGTTCTCTCGG
GTATTCTACATTCTCTTGTTTACTTAAGATATACCAAAATTCAAAAAATAAGTGTAATGTTCGCTTAGTATATTGAAAAATTAA
GATTTCCTAAAAAAAATTATTGAGCAATGCTAAAAGATAAGTTTAGACACAGCATGTTTAGACACAGTTTAGACACAGGGTGGTATACAGCATGTCTAACAGTTTTTTGAACATTGTAAT
TAACAAATACAAGATCTTAGTTATTAATTTTGGAATGTTTCGTTGAATTGACAGGAGGACACACACTAGGATTTGCCCACTGCTCATCGTTCCAGAATAGGATCCACAACTTCAACTTAC
AAAAACAGGTCGACCCAACACTAAACCCATCATTCGCGGCCAGCTTGAACGTAATTTGCCCTGCCCATAACAAGGTGAAAAACGCTGGTGCGACCATGGATGCAACCACAACGTACTTCG
ACAATGTTTACTACAAGATGCTTATGCAAGGCCAGTCACTCTTCTCATCTGACCAAGCGCTTCTCACTACTCCATCAAGTAAAAAACTCGTGGCCAAGTACGCGAGTTCCATGGAAGAAT
ACGAGAGGGCTTTTGTGAAGTCCATAATCAAGATGAGTAGTATCAGTGGGAATGGTAAAGAGGTCAGGCATAACTGCAGGAGGGTTCGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACATTTTCCCTATCTCCTTCTCACGGTCATCTTATCAGTTTCATTCAACGTTGAAGCACTCAGTCCTCACTACTACGACCAGTCATGTCCACAAGCCGACCACATTGTAACC
AATGCAGTCAAGAAAGCAATGTCGAACGACAAAACTGTCCCTGCTGCACTCTTGAGGATGCATTTTCACGACTGCTTTGTTAGG
GGATGTGATGCGTCGGTGCTTTTAGACTCGAAGGGA
AAGAACAAAGCCGAGAAAGATGGACCTCCTAACATCTCACTCCATGCGTTTTATGTGATTGACAATGCAAAGAAGGCATTAGAAGAGCAATGTCCCGGTGTTGTCTCTTGTGCAGATATC
CTTTCACTCGCTGCAAGAGATGCAGTCGCTCTC
TCAGGAGGGCCAACGTGGGAAGTTCCAAAAGGGAGAAAAGATGGAAGAATATCAAAGGCAATAGAAACAAGACAACTACCAGCTCCT
ACGTTCAACATATCTCAATTGCAACAAAGCTTTGGCCAAAGAGGCCTCTCTATGCACGATCTTGTTGTTCTCTCGG
GAGGACACACACTAGGATTTGCCCACTGCTCATCGTTCCAGAAT
AGGATCCACAACTTCAACTTACAAAAACAGGTCGACCCAACACTAAACCCATCATTCGCGGCCAGCTTGAACGTAATTTGCCCTGCCCATAACAAGGTGAAAAACGCTGGTGCGACCATG
GATGCAACCACAACGTACTTCGACAATGTTTACTACAAGATGCTTATGCAAGGCCAGTCACTCTTCTCATCTGACCAAGCGCTTCTCACTACTCCATCAAGTAAAAAACTCGTGGCCAAG
TACGCGAGTTCCATGGAAGAATACGAGAGGGCTTTTGTGAAGTCCATAATCAAGATGAGTAGTATCAGTGGGAATGGTAAAGAGGTCAGGCATAACTGCAGGAGGGTTCGTTAG

Retrieve as FASTA