Entry information : TsPrx[P]44 (Thhalv10026803m)
Entry ID 9812
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-29 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-04 (Christophe Dunand)
Peroxidase information: TsPrx[P]44 (Thhalv10026803m)
Name (synonym) TsPrx[P]44 (Thhalv10026803m)
Class Class III peroxidase     [Orthogroup: Prx025]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx[P]44
start..stop
S start..stop
TsPrx44 553 0 1..312 1..312
AlyPrx44-1 548 0 1..312 1..312
AlyPrx44-2 545 0 1..312 1..312
CrubPrx117 543 0 1..312 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5973148..5973348 201 N° 2 5972607..5973043 437 N° 3 5972202..5972499 298  
complement(join(5972202..5972499,5972607..5973043,5973148..5973348))


exon

Literature and cross-references TsPrx[P]44 (Thhalv10026803m)
DNA ref. Phytozome 12:   scaffold_1 (5973348..5972202)
Protein sequence: TsPrx[P]44 (Thhalv10026803m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (291)
PWM (Da):   %s   33741.17 (31507.0)  
PI (pH):   %s   9.7 (9.78) Peptide Signal:   %s   cut: 21 range:21-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAITALFFLFCLYVPSAFAQLRFGFYGQSCHRAGSIISNVVASHFRRDPSITAALLRMQFHDCFVTGCDASLLIDPRPGRPSEKSTGPNASVRGYEIIDEAK*LLEAACPGIVSCADIVTLATRDSIKLAGGPSFLVPTGRRDGLRSNPNDVNLPGPTIPVDASIRAFADQGMNVNDMVTLIGGGHSVGVAHCSLFQDRLNDPAMDRTLNARLRNTCRAPNDPSVFLDQRTSFTVDNAIYGEIQRQRGILRIDQNMGLHGPTRGIVSRFASSNALFRQRFAQAMVKMGTIKVLTGRSGEIRRNCRVFNNG

Retrieve as FASTA  
Remarks Pseudogene from genomic. Stop in frame (Maybe due to bad sequencing). Incorrect prediction from phytozome (a part of exon 2 was missing which has been completed). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCAATCACTGCTTTGTTCTTCCTTTTCTGTTTATATGTTCCCTCTGCTTTTGCACAACTCCGGTTTGGTTTCTACGGCCAGTCATGCCACCGCGCCGGATCAATCATTTCTAAT
GTCGTTGCCAGCCATTTCCGCCGTGACCCTTCAATTACTGCAGCATTGCTTCGCATGCAGTTTCATGATTGCTTTGTCACG
GTTCGTAAGCTTCTCCTTGTGTCAGTGTGTGTATATATC
ATGGACTTGCTAATTAATATCTAGACATAACACTGATCAAGCAATTGTGTTGAATGGTTGTGTAGGGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCCGGAAGACCATCCGAGAAAA
GCACCGGACCAAATGCAAGCGTGAGAGGCTACGAGATCATTGATGAGGCAAAGTGACTCCTTGAGGCTGCCTGTCCCGGAATTGTCTCATGCGCAGACATTGTAACTCTAGCCACCAGAG
ACTCGATCAAATTAGCTGGTGGTCCAAGCTTCTTAGTACCAACAGGAAGGCGTGATGGATTAAGGTCAAACCCCAATGATGTGAACTTGCCCGGACCAACAATTCCGGTGGATGCATCTA
TCCGAGCATTTGCAGATCAAGGCATGAATGTGAACGATATGGTTACACTTATTGGTGGTGGCCACAGTGTCGGTGTTGCGCATTGCAGTCTTTTCCAGGATAGGCTTAACGACCCTGCAA
TGGACCGCACATTGAATGCTAG
GTACGTATTTTGATACATAGCATCAAAATTCTTGGTTCATTTGAGAATATAGTTTATCAAATGAAACATCAAAAATTGTATCTGACCCAATAATACGT
ATCTTTAAGGTTGAGGAACACGTGTCGCGCTCCAAATGACCCATCCGTGTTCTTGGATCAAAGGACCTCATTCACCGTGGATAACGCAATCTATGGAGAGATCCAAAGACAAAGAGGAAT
CCTAAGAATTGATCAGAACATGGGTCTCCATGGACCAACACGTGGAATTGTGTCGAGATTTGCATCAAGCAATGCACTCTTTAGACAGAGATTTGCTCAAGCAATGGTGAAAATGGGTAC
CATTAAGGTTCTTACTGGACGTTCTGGAGAGATCAGGAGAAACTGCAGAGTCTTCAACAACGGACGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCAATCACTGCTTTGTTCTTCCTTTTCTGTTTATATGTTCCCTCTGCTTTTGCACAACTCCGGTTTGGTTTCTACGGCCAGTCATGCCACCGCGCCGGATCAATCATTTCTAAT
GTCGTTGCCAGCCATTTCCGCCGTGACCCTTCAATTACTGCAGCATTGCTTCGCATGCAGTTTCATGATTGCTTTGTCACG
GGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCCGGA
AGACCATCCGAGAAAAGCACCGGACCAAATGCAAGCGTGAGAGGCTACGAGATCATTGATGAGGCAAAGTGACTCCTTGAGGCTGCCTGTCCCGGAATTGTCTCATGCGCAGACATTGTA
ACTCTAGCCACCAGAGACTCGATCAAATTAGCTGGTGGTCCAAGCTTCTTAGTACCAACAGGAAGGCGTGATGGATTAAGGTCAAACCCCAATGATGTGAACTTGCCCGGACCAACAATT
CCGGTGGATGCATCTATCCGAGCATTTGCAGATCAAGGCATGAATGTGAACGATATGGTTACACTTATTGGTGGTGGCCACAGTGTCGGTGTTGCGCATTGCAGTCTTTTCCAGGATAGG
CTTAACGACCCTGCAATGGACCGCACATTGAATGCTAG
GTTGAGGAACACGTGTCGCGCTCCAAATGACCCATCCGTGTTCTTGGATCAAAGGACCTCATTCACCGTGGATAACGCAATC
TATGGAGAGATCCAAAGACAAAGAGGAATCCTAAGAATTGATCAGAACATGGGTCTCCATGGACCAACACGTGGAATTGTGTCGAGATTTGCATCAAGCAATGCACTCTTTAGACAGAGA
TTTGCTCAAGCAATGGTGAAAATGGGTACCATTAAGGTTCTTACTGGACGTTCTGGAGAGATCAGGAGAAACTGCAGAGTCTTCAACAACGGACGT

Retrieve as FASTA