Entry information : TsPrx26 (Thhalv10001541m)
Entry ID 9813
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsPrx26 (Thhalv10001541m)
Name (synonym) TsPrx26 (Thhalv10001541m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx26
start..stop
S start..stop
AhalPrx12 642 0 1..335 1..335
BstrPrx74 641 0 1..335 1..335
AlyPrx26 637 0 1..335 1..335
AtPrx26 637 0 1..335 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 117534..117779 246 N° 2 118462..118641 180 N° 3 118757..118916 160 N° 4 119221..119642 422
join(117534..117779,118462..118641,118757..118916,119221..119642)


exon

Literature and cross-references TsPrx26 (Thhalv10001541m)
DNA ref. Phytozome 12:   scaffold_22 (117534..119642)
Protein sequence: TsPrx26 (Thhalv10001541m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   37439.69 (34693.4)  
PI (pH):   %s   8.46 (8.70) Peptide Signal:   %s   cut: 26 range:26-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVMIHFFLAAVMVGAISLCPETAEAAVMGPSMQKLTWHYYKVYNTCENAENFVRHQVEKFYKSDKSIAPKLLRLLYSDCFVTGCDASILLEGPNSERMAPQNRGLGAFVIIDKIKIVLEQRCPGVVSCADILNLATRDAVHKAGAPSYPVFTGRRDGLTSDKQTVDLPSPSISWDTAMAYFKSRGLSVLDMATLLGSHSMGKTHCSYVVDRLHNFNKTGKPSSTINKSFLTEMAKQCPPRTRKGQTDPLVYLNPDSGSEHSFSSSFYSRVLSQKSVLEVDQQLLYNDDTKQISEEFSESFEDFRKSFALSMSKMGAINVLTKNEGEIRRDCRRRN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTATGATTCACTTCTTCCTCGCAGCGGTGATGGTTGGAGCCATCAGCCTCTGCCCGGAGACGGCAGAAGCCGCCGTTATGGGGCCGTCGATGCAGAAACTGACATGGCATTACTAC
AAAGTTTACAACACTTGCGAGAATGCCGAGAATTTTGTGAGGCACCAAGTTGAGAAGTTCTACAAGAGTGATAAAAGCATTGCTCCTAAGCTCCTCCGTCTCCTCTACTCCGATTGCTTT
GTCACA
GTAAGTTTTTTCTTATTCTTGTCTAACTAATCTTATCATTTATCTATCATATGAATATATACCTATATATGTATTAAGAGGATTTAATTAGAAAATTTGCGCGGGACTGATCCA
CGCACTGACGCACGGAGACAAATTAATGTAATCGAACAAATGAAACCAAACTAAAACGAAATGTTACAAACCTAACCTGGATTGGTCTTATTTTATTTTATCTTCTTAACGGTACTGGTC
TTCTTATTTTAATCTTTATTACTGAAACCGAAACTGATTTTGTATTTTTAACATATAGAGAAACCGATTTCATCTTTATCCAAAAAAAAGAGAAACCAATTTCAGCATAACTACTTAAGT
AAAACCATGATTTATTAACGTTGCATATTTTGTTTGTTATGTATAAATTAATAATAGATGTATTCATCGAAAAAATTATATTTTAAAGTTTTAATCATAAGTATAATATACAGTAATTAC
TACCTTTTTTTTACCTAAAACAGAAACAAATCTAAATCGAACCAAACTAAAACTGCACCTAACCGAACTAGTAAGAAACCTAAAGAGTATTTTTAATTCACTTTTTGTAAAACCTTAGAA
CTAAAGCGAAACCAAGCTATTAACTGGAGTGGTGTTATTTTAAGAATTAGTCACCGAACATTGTATGTATGTGACTCTATAATGTTAGGGATGCGATGCATCGATTCTTCTAGAAGGTCC
AAACTCGGAGAGAATGGCGCCACAAAACAGAGGACTTGGAGCATTCGTGATCATAGACAAAATCAAAATAGTCTTGGAACAAAGATGTCCCGGTGTTGTCTCTTGCGCCGACATTCTTAA
TCTTGCAACTCGGGATGCTGTTCATAAG
GTTTATATATCTCCTTCCTTTTCAATCTCTCTTTCTCTTTATCCATATTATATGGATCATCATCTGTAGATACTGACCAGCTTCGATATACG
GGAAAATTAATGATTTCCTACAGGCGGGTGCACCATCTTATCCTGTGTTCACGGGCAGGAGAGATGGCTTGACTTCAGATAAGCAAACCGTGGACCTACCATCACCGTCCATCTCATGGG
ATACAGCCATGGCTTACTTCAAATCCAGAGGCTTGAGTGTTCTTGACATGGCTACACTTCTAG
GTCAGTCACCTTTTTCTTCCTGACATCTTTAAAACCGGTTAATCAGGATTTAGGATT
ACCCATACGGTGTTTCGGATTGGGTTTTAAATCTCCGGTTTATGAATTATCGAAATCAATGAGAAATGAACAAAATTCTCACTCGGTTCGGTTAAGTATAGGCTCGGTGTCAGTTCAATG
GAACTTTTCGGTTTGAATTCAGTTACGGTTTGTTTGTTTATAGAAAAAAGGAAACCAAATCGGTTTATTTGAAGGTTGTTTTGGTTTAGTTTGAATCAGTTAAATTGAGCTGCACCTCCT
TAACCAGGATCACATTCAATGGGGAAAACACATTGCAGCTACGTCGTTGACCGTCTCCACAATTTCAACAAGACCGGTAAACCAAGCTCGACCATAAACAAGTCTTTCTTGACCGAAATG
GCAAAGCAATGTCCACCAAGAACGAGGAAAGGCCAGACTGATCCGCTCGTGTACCTAAACCCGGACTCAGGATCAGAGCACAGCTTCTCAAGCTCATTCTACTCACGGGTTCTGTCACAA
AAATCTGTACTTGAAGTAGATCAACAACTACTTTACAATGATGACACCAAACAGATCTCTGAGGAGTTCTCAGAGAGTTTTGAGGATTTTCGGAAATCATTTGCACTTTCGATGAGCAAA
ATGGGAGCCATAAATGTGTTAACTAAAAACGAAGGTGAGATAAGAAGAGATTGCAGGCGTAGAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTATGATTCACTTCTTCCTCGCAGCGGTGATGGTTGGAGCCATCAGCCTCTGCCCGGAGACGGCAGAAGCCGCCGTTATGGGGCCGTCGATGCAGAAACTGACATGGCATTACTAC
AAAGTTTACAACACTTGCGAGAATGCCGAGAATTTTGTGAGGCACCAAGTTGAGAAGTTCTACAAGAGTGATAAAAGCATTGCTCCTAAGCTCCTCCGTCTCCTCTACTCCGATTGCTTT
GTCACA
GGATGCGATGCATCGATTCTTCTAGAAGGTCCAAACTCGGAGAGAATGGCGCCACAAAACAGAGGACTTGGAGCATTCGTGATCATAGACAAAATCAAAATAGTCTTGGAACAA
AGATGTCCCGGTGTTGTCTCTTGCGCCGACATTCTTAATCTTGCAACTCGGGATGCTGTTCATAAG
GCGGGTGCACCATCTTATCCTGTGTTCACGGGCAGGAGAGATGGCTTGACTTCA
GATAAGCAAACCGTGGACCTACCATCACCGTCCATCTCATGGGATACAGCCATGGCTTACTTCAAATCCAGAGGCTTGAGTGTTCTTGACATGGCTACACTTCTAG
GATCACATTCAATG
GGGAAAACACATTGCAGCTACGTCGTTGACCGTCTCCACAATTTCAACAAGACCGGTAAACCAAGCTCGACCATAAACAAGTCTTTCTTGACCGAAATGGCAAAGCAATGTCCACCAAGA
ACGAGGAAAGGCCAGACTGATCCGCTCGTGTACCTAAACCCGGACTCAGGATCAGAGCACAGCTTCTCAAGCTCATTCTACTCACGGGTTCTGTCACAAAAATCTGTACTTGAAGTAGAT
CAACAACTACTTTACAATGATGACACCAAACAGATCTCTGAGGAGTTCTCAGAGAGTTTTGAGGATTTTCGGAAATCATTTGCACTTTCGATGAGCAAAATGGGAGCCATAAATGTGTTA
ACTAAAAACGAAGGTGAGATAAGAAGAGATTGCAGGCGTAGAAACTAA

Retrieve as FASTA