Entry information : TsAPx04 (Thhalv10025942m)
Entry ID 9814
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsAPx04 (Thhalv10025942m)
Name (synonym) TsAPx04 (Thhalv10025942m)
Class Ascorbate peroxidase    [Orthogroup: APx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsAPx04
start..stop
S start..stop
AhalAPx03 533 0 1..278 1..278
AlyAPx04 528 0 1..278 1..278
AtAPx04 525 0 1..278 1..278
CagraAPx04 513 0 1..278 44..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1732523..1732632 110 N° 2 1732317..1732441 125 N° 3 1732171..1732220 50 N° 4 1732013..1732078 66
N° 5 1731869..1731914 46 N° 6 1731700..1731782 83 N° 7 1731539..1731618 80 N° 8 1731355..1731457 103
N° 9 1731079..1731261 183  
complement(join(1731079..1731261,1731355..1731457,1731539..1731618,1731700..1731 782,1731869..1731914,1732013..1732078,1732171..1732220,1732317..1732441,1732523. .1732632))


exon

Literature and cross-references TsAPx04 (Thhalv10025942m)
DNA ref. Phytozome 12:   scaffold_1 (1732632..1731079)
Protein sequence: TsAPx04 (Thhalv10025942m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   30901.88 Transmb domain:   %s   o250-272i
PI (pH):   %s   8.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVNVDAEYLKEIEKTRRDLRALISSRNCAPIMLRLAWHDAGTYDAKKKTGGPNGSIRFKDELNRSHNNGLEKAVAFCEEVKAKHPRVSYADLYQLAGVVAVEVTGGPAIQFSPGRKDADSPDEGELPDPNQGASHLRTLFSRMGLSDRDIVALSGGHTLGRAHKDRSDFEGAWTQDPLKFDNSYFVELLKGETPGLLQLKTDKALLGDSKFHPYVELYAKEENVFFKDYANSHKKLSELGFNPPRKIPSAVTQQTLGIAVAAAVVIFTICYEATRGGGKK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGAACGTTGATGCAGAGTACCTCAAAGAGATAGAGAAGACTCGTCGTGACCTTCGAGCTCTTATCTCTTCTAGAAACTGTGCTCCTATAATGCTCCGTCTTGCGTAAGATTCA
GAATCACTCTCTATTTTTCTTTCTTTCTTGTCTTAACGTTTCCAAATGCAAAAATTCTTGTCCGCGTGTAGATGGCATGATGCAGGAACTTATGATGCCAAGAAGAAAACCGGAGGCCCC
AATGGTTCTATTAGGTTCAAGGACGAGCTAAACCGCTCGCACAACAATGGTTTGGAGAAAGCTGTCGCCTTCTGCG
GTTAGTTTCTTTTGATGCTTTTTATCTATTGTTCAGGACAATCT
TTGGTTGCTTGCTGTTTCCTTTGATGTTTGAATTTTTGGTTTCTGGTTTCAGAGGAAGTAAAGGCTAAGCATCCGCGAGTCTCTTATGCAGACCTTTATCAGGTTAACATTGATATATCT
ATGGTATTTCTAAGCCATTTAACTCATACAAACCTTTCTTCCTCGTTGACAGAGATTCTTTGTTTTCATTTCAGCTCGCTGGAGTTGTTGCAGTGGAGGTTACCGGTGGCCCTGCAATCC
AATTTTCTCCAGGCCGTAAG
GTACTTGCCTTTTATCGCGCGTTAGAACCATAGTATTTGCTAAGTGTGTTTCTAGAAAAAAAGAGAGAATCTTATAATCATTGGGAAAATGATTGCAGGA
TGCTGATTCCCCAGACGAAGGAGAACTTCCTGATCCAAATCAAG
GTTCCTCCCGCAGCTTGTAGCTCCTGTGCAATGCAATGGAATCCTATTTCACAAACTGATTAAACCATTCTTTTGG
ATTACTGCAGGTGCCTCACATCTAAGAACTCTCTTCTCTCGCATGGGTTTATCGGATAGAGACATTGTAGCTCTCTCTGGAGGCCACACTTTGGTAACTAACTAACTCTTCTGAAGATAT
CGTCTCTAAACGTCTTTTAGTTGACACCAACGTGGTTGATGCTTTTGTATATAGGGACGTGCACATAAGGATAGATCAGACTTTGAAGGTGCTTGGACACAAGATCCTCTCAAGTTTGAT
AACTCATATTTCGT
GTAAGCCAACAACAAAATCATCACAAAGCTAGGGAAAGAGTCCTGAAACTTAATTACATTGGTTTCTGATTGATGTTTCAGAGAGCTCCTGAAAGGGGAGACGCCA
GGATTGCTACAACTGAAAACCGACAAGGCTCTACTTGGTGATTCCAAGTTCCACCCCTATGTTGAGTTGTATGCAAAG
GTATATTAATTTTGATTTCGGGACAATTATAAAAAATCTAGG
AATTCTCTGGCTTAATCAGTAAAAAAAAGGTGATAACGATGTGTATGACAGGAAGAAAATGTGTTCTTCAAAGACTATGCAAATTCACACAAGAAACTCTCAGAACTAGGATTTAATCCG
CCGAGAAAAATTCCTTCAGCAGTGACGCAGCAGACGCTTGGAATCGCTGTTGCTGCAGCTGTTGTGATCTTTACCATATGCTACGAAGCAACCAGAGGAGGAGGCAAAAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGAACGTTGATGCAGAGTACCTCAAAGAGATAGAGAAGACTCGTCGTGACCTTCGAGCTCTTATCTCTTCTAGAAACTGTGCTCCTATAATGCTCCGTCTTGCATGGCATGAT
GCAGGAACTTATGATGCCAAGAAGAAAACCGGAGGCCCCAATGGTTCTATTAGGTTCAAGGACGAGCTAAACCGCTCGCACAACAATGGTTTGGAGAAAGCTGTCGCCTTCTGCG
AGGAA
GTAAAGGCTAAGCATCCGCGAGTCTCTTATGCAGACCTTTATCAG
CTCGCTGGAGTTGTTGCAGTGGAGGTTACCGGTGGCCCTGCAATCCAATTTTCTCCAGGCCGTAAGGATGCTGAT
TCCCCAGACGAAGGAGAACTTCCTGATCCAAATCAAG
GTGCCTCACATCTAAGAACTCTCTTCTCTCGCATGGGTTTATCGGATAGAGACATTGTAGCTCTCTCTGGAGGCCACACTTTG
GGACGTGCACATAAGGATAGATCAGACTTTGAAGGTGCTTGGACACAAGATCCTCTCAAGTTTGATAACTCATATTTCGTAGAGCTCCTGAAAGGGGAGACGCCAGGATTGCTACAACTG
AAAACCGACAAGGCTCTACTTGGTGATTCCAAGTTCCACCCCTATGTTGAGTTGTATGCAAAG
GAAGAAAATGTGTTCTTCAAAGACTATGCAAATTCACACAAGAAACTCTCAGAACTA
GGATTTAATCCGCCGAGAAAAATTCCTTCAGCAGTGACGCAGCAGACGCTTGGAATCGCTGTTGCTGCAGCTGTTGTGATCTTTACCATATGCTACGAAGCAACCAGAGGAGGAGGCAAA
AAATGA

Retrieve as FASTA