Entry information : TsAPx03 (Thhalv10025911m)
Entry ID 9815
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-12 (Christophe Dunand)
Peroxidase information: TsAPx03 (Thhalv10025911m)
Name (synonym) TsAPx03 (Thhalv10025911m)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type Leaves
Inducer Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value TsAPx03
start..stop
S start..stop
BnAPx03-1Aa_other 547 0 1..287 1..287
AtAPx03 533 0 1..287 1..287
CagraAPx03-1 533 0 1..287 1..287
BstrAPx03 532 0 1..287 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2153311..2153423 113 N° 2 2153594..2153718 125 N° 3 2153977..2154026 50 N° 4 2154444..2154509 66
N° 5 2154600..2154648 49 N° 6 2154771..2154853 83 N° 7 2154943..2155022 80 N° 8 2155170..2155272 103
N° 9 2155572..2155766 195  
join(2153311..2153423,2153594..2153718,2153977..2154026,2154444..2154509,2154600 ..2154648,2154771..2154853,2154943..2155022,2155170..2155272,2155572..2155766)


exon

Literature and cross-references TsAPx03 (Thhalv10025911m)
Literature Wong,C.E., Li,Y., Whitty,B.R., Diaz-Camino,C., Akhter,S.R., Brandle ,J.E., Golding,G.B., Weretilnyk,E.A., Moffatt,B.A. and Griffith,M. Expressed sequence tags from the Yukon ecotype of Thellungiella reveal that gene expression in response to cold, drought and salinity shows little overlap. Plant Mol. Biol. 58 (4), 561-574 (2005).
DNA ref. Phytozome 12:   scaffold_1 (2153311..2155766)
EST ref. GenBank:   DN778946.1 [5' end]
Protein sequence: TsAPx03 (Thhalv10025911m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31695.18 Transmb domain:   %s   o258-280i
PI (pH):   %s   6.88
Sequence 329
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPIVDAEYLKQINKARRELRSLIANRNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEFNHGANSGLKIALDLCESVKAKHPKITYADLYQLAGVVAVEVTGGPDISFVPGRKDSNVCPREGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESDGLLKLPTDKTLLEDPEFRRYVEIYAKDEDAFFKDYSESHKKLSELGFNSNPSAAKAVADSTVLAQSAFGVAIAAAVVALSYFYEIRKRMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCACCGATTGTTGACGCGGAGTACTTGAAGCAGATAAACAAGGCTCGCCGTGAACTCCGCTCTCTCATCGCGAACAGGAACTGCGCTCCGATCATGCTTCGATTGGCGTAAGTTT
CTTCCATTTTTCTGGTTTTCATGGCTTCGCTTATGTTGACTGCGACGTGCCTTCGTCTGTGTTCTCTGGAAAAAAAGTCTGGATTATAGTTAGGTTGTGGAAATTGCTGGATCTCGTTTC
GTTTTAGCTGTTGAAATGTTGTCTTCTCTGGTTTTTATGAAGATGGCACGATGCTGGAACCTATGATGCTCAATCGAAGACCGGTGGACCTAATGGCTCGATCAGGAACGAGGAGGAGTT
CAATCATGGTGCTAACAGTGGTTTGAAAATCGCTCTCGATCTCTGTG
GTGTGTTTTTCTCTTCCCTACTTCTTGTGTTGAAGGTTTAGATTTAGTGATTATAGAGTGTACTGTTGATCTT
TCATGGCACAATTTCTCAATTTACTTGCATGATCCAGATATTTTTACTTGTCAGCCAGTGGGATAGATGATTGTGAATTTGGATAGCCAATACTGTGTTCTCTCATATGGTGTATCCTGT
TTGTCTTATGGTTTAAGAAGACTGTTTAAAGTAACCCCGTTGTGCTTTGATGTTTGATGTTTCAGAGAGCGTGAAAGCTAAACATCCCAAAATCACATATGCGGACCTATACCAGGTGAT
TACGATATCTAGTTTAAATATTTTAACATAACAGCAAGGTTCCTACCGGAGTTAGGACTGAATGAATTTCCTAATGGATGCATTTTATTAGTTTTGTCAGCCATATAATTTCCAGATGGT
CTTGTTGTTTTCGACTGCTCCTTTGTCAAGAATACTCTGGAACTCAATCCTGCTGGTGTGTCATTACCAAGAGTTTTGTGTGAAATTTTCTGTTAGATAATTAGACTTGGACTGAATAGA
ATTCACATATCTGTCACTCGCACGTATATCACATCTTGTACTGTTTGTATTGTCGTTTGTCCATTATCTGTCTTCTTTCTTATAATATCAATACGTAATATAGGAATCTTTTAAAAGAAG
CGTCCCAGACGGATCATCGGATGTCAATAATTTACTTAATCTTTTGTTTCAGCTTGCTGGTGTGGTAGCAGTGGAGGTTACTGGTGGACCTGATATCAGCTTTGTTCCGGGGAGAAAAGT
ATGTTTCTCCTTCTTTGAGCATTATAACAGCTTACCAGTTTAACATTGAAGCACATAACCATAACTAATGTTTCTTTCTTCCTGATAGGATTCAAATGTTTGCCCGAGGGAAGGAAGACT
TCCTGATGCTAAACAAG
GTACCACAAAATTGTTATATCATTTATAACAAACTTTTCTGCTGAAACTCTAAGCATGGAATTGGAAGACCTTCTCTATGAATTTACTATTCCCTTTTGAGAA
TTTGAAGTTGTGTCTGCAGGTTTCCAACACCTTAGAGATGTCTTCTACCGCATGGGACTATCTGATAAGGATATTGTGGCACTCTCAGGGGGTCATACTCTGGTAAATTCATCGTTCTTA
AATCAACATCCGTTGTTTTTCTCAACAAATAAAAGGTTTGCTCGTGCTTATGGCTACTTTTGGGTGTTTAGGGAAGGGCTCATCCAGAGAGGTCAGGGTTTGATGGGCCATGGACTCAAG
AGCCTCTGAAGTTTGATAACTCCTACTTCGT
GTAATTTTCATTTCTTTATCCTCAGAGCTTTTAAATCTTCTTTGTTTCTAATTTTTTTTCCTGTTTGTGTTTCCAAGAAGAACAAAGCT
CACAGCTACTTTATTACATGATCGGTTAACCAGTGATTAATTACTGTTTTGGTACCAGTGAACTGCTGAAAGGAGAATCAGATGGCTTGTTGAAACTTCCTACTGACAAGACTTTATTGG
AAGACCCAGAGTTCCGTCGTTATGTTGAGATTTATGCTAAG
GTATGATATAACTCGATTGTCTTATTGATTTCACATTTTCATTGAATAACAAATCAAAGCTATCTAGAACCCTACGAAT
ACTAATTACCAATGATTGCTAATGTTGCAAGGTAATAAAATGACCACTCTTTACGAATTCTTATAATTCTATCATGGTGAATCGTGATCACAGTCCCTATTTCTGTACATGTTTGCTGTC
AATTAGCTCATAATTTCTGAGAATATGTAGATAGAAAATGGGACGCTTCACTACGATTTCTTTATTTGATTAATGATAAGCTCAATTTGTGTGGAGACAGGATGAGGATGCATTCTTCAA
AGACTACTCTGAATCGCACAAGAAACTCTCTGAGCTCGGTTTCAACTCGAATCCCTCGGCAGCTAAAGCAGTTGCAGACAGTACGGTTCTGGCTCAGAGCGCGTTCGGGGTTGCGATTGC
TGCTGCGGTCGTTGCGTTAAGTTACTTTTACGAGATTCGAAAGAGGATGAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCACCGATTGTTGACGCGGAGTACTTGAAGCAGATAAACAAGGCTCGCCGTGAACTCCGCTCTCTCATCGCGAACAGGAACTGCGCTCCGATCATGCTTCGATTGGCATGGCACG
ATGCTGGAACCTATGATGCTCAATCGAAGACCGGTGGACCTAATGGCTCGATCAGGAACGAGGAGGAGTTCAATCATGGTGCTAACAGTGGTTTGAAAATCGCTCTCGATCTCTGTG
AGA
GCGTGAAAGCTAAACATCCCAAAATCACATATGCGGACCTATACCAG
CTTGCTGGTGTGGTAGCAGTGGAGGTTACTGGTGGACCTGATATCAGCTTTGTTCCGGGGAGAAAAGATTCAA
ATGTTTGCCCGAGGGAAGGAAGACTTCCTGATGCTAAACAAG
GTTTCCAACACCTTAGAGATGTCTTCTACCGCATGGGACTATCTGATAAGGATATTGTGGCACTCTCAGGGGGTCATA
CTCTG
GGAAGGGCTCATCCAGAGAGGTCAGGGTTTGATGGGCCATGGACTCAAGAGCCTCTGAAGTTTGATAACTCCTACTTCGTTGAACTGCTGAAAGGAGAATCAGATGGCTTGTTGA
AACTTCCTACTGACAAGACTTTATTGGAAGACCCAGAGTTCCGTCGTTATGTTGAGATTTATGCTAAG
GATGAGGATGCATTCTTCAAAGACTACTCTGAATCGCACAAGAAACTCTCTG
AGCTCGGTTTCAACTCGAATCCCTCGGCAGCTAAAGCAGTTGCAGACAGTACGGTTCTGGCTCAGAGCGCGTTCGGGGTTGCGATTGCTGCTGCGGTCGTTGCGTTAAGTTACTTTTACG
AGATTCGAAAGAGGATGAAATAG

Retrieve as FASTA