Entry information : PcarDyPrx
Entry ID 9816
Creation 2011-11-21 (Christophe Dunand)
Last sequence changes 2011-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarDyPrx
Name PcarDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarDyPrx
start..stop
S start..stop
BaDyPrx08 733 0 1..561 12..570
BaDyPrx10 725 0 1..561 1..560
CcinDyPrx02 571 0 11..561 74..648
GluxDyPrx10 362 2.82e-119 94..557 69..520
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9816' 'join(994549..994701,994755..994790,994844..994884,994931..995005,995067..995896,995954..996134,996192..996328,996384..996664)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 994549..994701 151 N° 2 994755..994790 34 N° 3 994844..994884 39 N° 4 994931..995005 73
N° 5 995067..995896 828 N° 6 995954..996134 179 N° 7 996192..996328 135 N° 8 996384..996664 279
join(994549..994701,994755..994790,994844..994884,994931..995005,995067..995896, 995954..996134,996192..996328,996384..996664)


exon

Literature and cross-references PcarDyPrx
DNA ref. JGI genome:   scaffold_2 (994549..996664)
Protein sequence: PcarDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   577 (325)
PWM (Da):   %s   64671.36 (36873.6)  
PI (pH):   %s   5.47 (9.85) Peptide Signal:   %s   cut: 19 range:19-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLNLQNREPQIFMREQKETVTLTIRFHHARDMTTKGEALLATTVD
RTDTVK
LPSDKDDVVKYLIKVFDQAGSTRPDQETTVEFVRKVDLDPLGLGNIQGDVIPGLPKALEFFYYFQITNVDGFRTAFKDFVLPKIVTSASLVQNPPPSPRDNRDHPFRGLAIGFSSLGIRK
FRLNPTELGDRAFARGQMADSQALGDAGAEREGFWSPNWDSEYKANIDGIFLITAYNESNARKFIDELEEAFRWAPNRSSLRKIVALYGHPRPEPEAINDPFGWRGGGFTNPQVEGVTFS
EEKPMAYTGTPVIPLGVLVMGREGDEDKDRRPEWAKDGSLIATRKLNCLVPELESYLLEEGQKIFPNLSSADAAAKLGARLMGRWK
GTPVVLSPDNDAPEIAGDPARVNNFEFDKTDTNQ
KRCPFAAHMRKSNPRNDIDPNELKKH
LIRRHNMPYGPEVSDEERENGTSEDRGLHLCAYQSSIERGFRYIQEWYNNVNFPPGKPTTPGWDPIFGQTGQEDEGVYRQMSGVNPAQPKQVTS
FMEKFVDPRGGEYFFVPSMATLRQHIAAADPVFTAISCQVAAQG

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCAATCTCCAGAACCGCGAACCACAGATATTTATGCGGGAGCAGAAGGAGACGGTCACGCTCACCATCAGATTTCACCATGCCAGAGACATGACCACGAAAGGGGAAGCGCTTCTC
GCCACGACGGTAGACAGGACCGATACGGTTAAG
AGGTGATACTCTATCAGATTTCAACAGGTAAAAGGGCTCATTCATTCGTTTCAAGCTACCCTCAGATAAGGATGATGTGGTTAAATA
TCTT
TTGTATGCGCGGCTCGTGTTTGCTGCCGAGTTGCTAATATTGACATCCGCGCTAGATCAAGGTTTTTGATCAAGCTGGGAGCACTAGGCCTGACCACAGTGGGTTCTTCCTTTGTC
TGAATAACAGTCTGCTCACATTTGTCAGGGAAACGACGGTTGAATTTGTCCGGAAGGTCGATCTCGATCCTCTGGGACTCGGCAACATTCAGGGAGATGTGATATGTGCGTGCCGTGCCG
TCCACACCAGCCCCAGCTATTCGCGGCTTACTTGGCGTTGTCTCAGACCTGGACTTCCCAAGGCTCTGGAATTTTTCTACTACTTCCAGATCACCAATGTTGACGGATTCCGCACGGCGT
TCAAGGATTTTGTCTTGCCTAAGATTGTCACATCCGCAAGCCTTGTACAGAACCCACCGCCTTCTCCACGGGATAACCGAGACCACCCTTTCCGCGGTCTTGCTATCGGTTTCTCAAGCT
TAGGTATCAGAAAGTTCCGCCTCAACCCTACCGAGCTCGGAGACCGCGCGTTCGCACGGGGGCAGATGGCGGACTCGCAGGCGCTCGGGGACGCGGGTGCCGAGCGGGAGGGGTTCTGGT
CGCCGAACTGGGACTCGGAATACAAGGCGAACATCGACGGTATCTTCCTCATCACAGCGTACAACGAGAGTAACGCGCGCAAGTTCATCGACGAGCTCGAGGAGGCCTTCCGCTGGGCGC
CGAACCGGTCGTCTTTGCGCAAGATCGTCGCGCTCTATGGGCATCCGCGCCCCGAACCTGAGGCTATAAATGATCCGTTCGGTTGGCGCGGGGGCGGCTTCACGAATCCACAGGTCGAGG
GCGTCACGTTCAGCGAGGAGAAACCGATGGCGTACACCGGCACGCCCGTGATCCCGCTCGGGGTACTCGTCATGGGGCGCGAAGGCGACGAGGACAAGGACAGGCGCCCCGAATGGGCCA
AGGATGGTAGTTTGATTGCGACGCGGAAGCTCAACTGTCTCGTCCCCGAGCTCGAAAGTTATCTGCTCGAGGAGGGTCAGAAGATCTTCCCGAACCTGAGCAGTGCCGACGCAGCCGCCA
AACTCGGCGCAAGGCTCATGGGCCGATGGAAGAACG
CGGTGTGCAACAGCCTTTGTATCTGTCTACTGCTCGCTCGTATTGACGACGTTCCCCAGGGACACCTGTCGTACTGTCTCCGGA
CAACGACGCGCCCGAGATCGCGGGGGACCCTGCGCGGGTGAACAACTTCGAGTTCGACAAGACCGATACGAATCAGAAACGGTGTCCGTTCGCAGCGCACATGCGCAAGTCGAACCCGCG
CAACGATATCGACCCTAACGAGCTGAAGAAGCATCT
CTGTGAGTGGCCGCTGGCTTGATTGGCGATTTGTCTTCTGACATGCCGTGTCATCGTAGCATCCGGAGGCATAACATGCCATAC
GGGCCCGAGGTCAGCGACGAGGAGCGCGAAAACGGTACGAGCGAAGACCGGGGTCTGCACCTCTGCGCGTACCAGAGCAGCATCGAACGGGGCTTCCGCTACATCCAATGCG
CGGTAGGC
ACTCCTCTGCGCGTTGCTGCACACACACTGACCCAGAGCCCACGCGTAGAGTGGTACAATAATGTTAACTTCCCTCCCGGGAAGCCAACGACGCCCGGCTGGGACCCAATTTTCGGGCAG
ACGGGGCAAGAGGACGAGGGCGTCTACCGACAGATGAGCGGCGTCAATCCTGCGCAGCCTAAGCAAGTGACGAGCTTCATGGAGAAGTTTGTCGATCCGCGGGGAGGGGAGTACTTCTTT
GTGCCATCCATGGCCACCTTGCGACAGCACATTGCGGCAGCGGATCCGGTTTTTACAGCGATCTCTTGTCAAGTGGCGGCCCAAGGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCAATCTCCAGAACCGCGAACCACAGATATTTATGCGGGAGCAGAAGGAGACGGTCACGCTCACCATCAGATTTCACCATGCCAGAGACATGACCACGAAAGGGGAAGCGCTTCTC
GCCACGACGGTAGACAGGACCGATACGGTTAAG
CTACCCTCAGATAAGGATGATGTGGTTAAATATCTTATCAAGGTTTTTGATCAAGCTGGGAGCACTAGGCCTGACCAGGAAACGACG
GTTGAATTTGTCCGGAAGGTCGATCTCGATCCTCTGGGACTCGGCAACATTCAGGGAGATGTGAT
ACCTGGACTTCCCAAGGCTCTGGAATTTTTCTACTACTTCCAGATCACCAATGTT
GACGGATTCCGCACGGCGTTCAAGGATTTTGTCTTGCCTAAGATTGTCACATCCGCAAGCCTTGTACAGAACCCACCGCCTTCTCCACGGGATAACCGAGACCACCCTTTCCGCGGTCTT
GCTATCGGTTTCTCAAGCTTAGGTATCAGAAAGTTCCGCCTCAACCCTACCGAGCTCGGAGACCGCGCGTTCGCACGGGGGCAGATGGCGGACTCGCAGGCGCTCGGGGACGCGGGTGCC
GAGCGGGAGGGGTTCTGGTCGCCGAACTGGGACTCGGAATACAAGGCGAACATCGACGGTATCTTCCTCATCACAGCGTACAACGAGAGTAACGCGCGCAAGTTCATCGACGAGCTCGAG
GAGGCCTTCCGCTGGGCGCCGAACCGGTCGTCTTTGCGCAAGATCGTCGCGCTCTATGGGCATCCGCGCCCCGAACCTGAGGCTATAAATGATCCGTTCGGTTGGCGCGGGGGCGGCTTC
ACGAATCCACAGGTCGAGGGCGTCACGTTCAGCGAGGAGAAACCGATGGCGTACACCGGCACGCCCGTGATCCCGCTCGGGGTACTCGTCATGGGGCGCGAAGGCGACGAGGACAAGGAC
AGGCGCCCCGAATGGGCCAAGGATGGTAGTTTGATTGCGACGCGGAAGCTCAACTGTCTCGTCCCCGAGCTCGAAAGTTATCTGCTCGAGGAGGGTCAGAAGATCTTCCCGAACCTGAGC
AGTGCCGACGCAGCCGCCAAACTCGGCGCAAGGCTCATGGGCCGATGGAAGAACG
GGACACCTGTCGTACTGTCTCCGGACAACGACGCGCCCGAGATCGCGGGGGACCCTGCGCGGGTG
AACAACTTCGAGTTCGACAAGACCGATACGAATCAGAAACGGTGTCCGTTCGCAGCGCACATGCGCAAGTCGAACCCGCGCAACGATATCGACCCTAACGAGCTGAAGAAGCATCT
CATC
CGGAGGCATAACATGCCATACGGGCCCGAGGTCAGCGACGAGGAGCGCGAAAACGGTACGAGCGAAGACCGGGGTCTGCACCTCTGCGCGTACCAGAGCAGCATCGAACGGGGCTTCCGC
TACATCCAATGCG
AGTGGTACAATAATGTTAACTTCCCTCCCGGGAAGCCAACGACGCCCGGCTGGGACCCAATTTTCGGGCAGACGGGGCAAGAGGACGAGGGCGTCTACCGACAGATG
AGCGGCGTCAATCCTGCGCAGCCTAAGCAAGTGACGAGCTTCATGGAGAAGTTTGTCGATCCGCGGGGAGGGGAGTACTTCTTTGTGCCATCCATGGCCACCTTGCGACAGCACATTGCG
GCAGCGGATCCGGTTTTTACAGCGATCTCTTGTCAAGTGGCGGCCCAAGGCTAA

Retrieve as FASTA