Entry information : TsPrx50 (Thhalv10025717m)
Entry ID 9818
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-07-27 (Christophe Dunand)
Peroxidase information: TsPrx50 (Thhalv10025717m)
Name (synonym) TsPrx50 (Thhalv10025717m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx50
start..stop
S start..stop
TsPrx51 509 0 23..325 23..329
ThPrx51 509 0 23..324 23..328
BnPrx50-1_other 509 0 19..324 17..326
BoPrx50_other 508 0 19..324 17..326
Gene structure Fichier Exons


exon

Literature and cross-references TsPrx50 (Thhalv10025717m)
DNA ref. Phytozome 12:   scaffold_1 (1018947..1017486)
Protein sequence: TsPrx50 (Thhalv10025717m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (300)
PWM (Da):   %s   35851.5 (33053.0) Transmb domain:   %s   i9-26o
PI (pH):   %s   8.2 (7.99) Peptide Signal:   %s   cut: 25 range:25-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDANKMNRLLLLLSLFLILNISSAQLRRNFYAGICPDVEQIVKKAVEQKVQQASITVPAILRLYFHDCFVNGCDASVMIESTNDNKAEKDHPDNLSLAGDGFDAIVKAKQALDAVPNCRN
KVSCADILTIATRDVVNIVGAPRYEVELGRLDGLSSTAARVEGKLPQPTDDVDKLTSHFAKNGLSLDDMIALSGAHTIGVAHCTKVLERIYGVKEDPKINATYLAQLKELCPRDVDPRRL
VVMDPTTPGKFDNVYYKNLQQGKGFFKSDQVLFSDRRSKPTVNLWASNEQLFNQAFVNSMIKLGRVGVKTGRDGNIRRDCEAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome. The extra short PS at 5' end has been removed. No EST.
DNA
Send to BLAST
CDS
Send to BLAST