Entry information : TsPrx47 (Thhalv10025702m)
Entry ID 9819
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsPrx47 (Thhalv10025702m)
Name (synonym) TsPrx47 (Thhalv10025702m)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx47
start..stop
S start..stop
AtPrx47 628 0 1..326 1..325
AlyPrx47 626 0 1..326 1..325
CrubPrx54 622 0 1..326 1..325
CagraPrx66 619 0 1..326 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2781891..2782139 249 N° 2 2781601..2781789 189 N° 3 2781362..2781524 163 N° 4 2780761..2781140 380
complement(join(2780761..2781140,2781362..2781524,2781601..2781789,2781891..2782 139))


exon

Literature and cross-references TsPrx47 (Thhalv10025702m)
DNA ref. Phytozome 12:   scaffold_1 (2782139..2780761)
Protein sequence: TsPrx47 (Thhalv10025702m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   36157.95 Transmb domain:   %s   i13-35o
PI (pH):   %s   8.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSRSLKMKNNKMVRANLLSVIMLMHAIVGLPYHVRGLSMSYYMMSCPFAEQIVKNSVNNALQADPTLAAGLIRMLFHDCFIEGCDASILLDSTKDNTAEKDSPANLSLRGYEIIDDAKDKIEKRCPGVVSCADIVAMAARDAVFWAGGPYYDMPKGRFDGKRSKIEDTRNLPSPFLNATQLIQTFGQRGFTPQDVVALSGAHTLGVARCSSFKARLTTTDSSLDSSFATTLSKTCSAGDNAEQPFDATRNDFDNAYFNALQRKSGVLFSDQTLFDTPRTRNLVNGYAFNQAKFFFDFQQAMRKMSNLDVKLASQGEVRQNCRRLN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTCGAGATCATTAAAGATGAAAAATAATAAGATGGTTAGGGCGAATTTATTGAGCGTGATTATGTTGATGCATGCAATAGTTGGGCTTCCATATCATGTGAGGGGTTTAAGCATG
AGTTACTACATGATGAGCTGTCCTTTCGCAGAACAGATTGTGAAGAACAGTGTTAACAATGCTCTTCAAGCCGATCCCACTTTAGCCGCAGGTCTTATCCGTATGCTCTTCCACGACTGT
TTCATTGAG
GTAATTTACGTTTTCTCTTAATTTAAGTCTTTCCTTTACGTACGTACAAGAACCCATTAGTTTGGAAAAGCTAAGTTATTTTTTTGGTGTGTCTTACGAAGGGATGTGACG
CTTCGATTCTACTCGATTCAACAAAAGACAATACTGCGGAAAAGGATTCGCCTGCGAATCTGAGTCTACGTGGCTACGAGATCATAGATGATGCAAAAGATAAAATCGAGAAAAGATGTC
CAGGAGTTGTATCTTGCGCAGATATTGTTGCCATGGCTGCTAGAGATGCTGTCTTTTGG
GTAAGCTAATCAAGATTTGATCACTTATTAATGATGATATTTTTGTACTTAATCAAAAAGA
ATTGTTGTTAATTAGGCTGGTGGTCCATATTATGACATGCCAAAAGGAAGATTTGATGGTAAGAGATCGAAGATAGAAGATACAAGAAATCTTCCTTCACCATTTCTCAATGCCACCCAA
CTCATTCAAACTTTTGGCCAACGCGGCTTCACTCCACAGGATGTTGTTGCTCTCTCCG
GTAAGTTCTTTATGACAAGCCAACAACACATTAGGTTCCTTTCCATATATATAATATTATAA
CAGTATGATGTTATTAAATATAAATTTGTAGTTATTAAGTAAAAACAAAATTACAAGATTATATAAAAAAAATTATCTTATATGCTATTGGAATTTGGAATCCATGTACATGCAACATGT
TTTGGTTCTAACTTAACTGGTGGAACTATATATATATAGGAGCACATACACTTGGAGTTGCGAGATGCTCCTCCTTCAAGGCTAGACTTACCACCACAGATTCTTCACTGGACTCTTCTT
TTGCAACCACTCTCTCTAAAACATGCAGTGCGGGTGACAATGCAGAGCAACCATTTGATGCCACGCGCAACGATTTCGACAATGCTTACTTCAATGCGCTTCAGAGGAAATCAGGAGTCC
TCTTTTCAGACCAAACCTTATTCGACACTCCAAGGACCAGGAATCTTGTTAATGGCTATGCCTTTAACCAAGCTAAGTTTTTCTTTGATTTCCAACAGGCCATGCGCAAAATGAGCAATC
TTGATGTCAAACTTGCCTCTCAAGGTGAGGTCCGTCAAAATTGTCGGAGACTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTCGAGATCATTAAAGATGAAAAATAATAAGATGGTTAGGGCGAATTTATTGAGCGTGATTATGTTGATGCATGCAATAGTTGGGCTTCCATATCATGTGAGGGGTTTAAGCATG
AGTTACTACATGATGAGCTGTCCTTTCGCAGAACAGATTGTGAAGAACAGTGTTAACAATGCTCTTCAAGCCGATCCCACTTTAGCCGCAGGTCTTATCCGTATGCTCTTCCACGACTGT
TTCATTGAG
GGATGTGACGCTTCGATTCTACTCGATTCAACAAAAGACAATACTGCGGAAAAGGATTCGCCTGCGAATCTGAGTCTACGTGGCTACGAGATCATAGATGATGCAAAAGAT
AAAATCGAGAAAAGATGTCCAGGAGTTGTATCTTGCGCAGATATTGTTGCCATGGCTGCTAGAGATGCTGTCTTTTGG
GCTGGTGGTCCATATTATGACATGCCAAAAGGAAGATTTGAT
GGTAAGAGATCGAAGATAGAAGATACAAGAAATCTTCCTTCACCATTTCTCAATGCCACCCAACTCATTCAAACTTTTGGCCAACGCGGCTTCACTCCACAGGATGTTGTTGCTCTCTCC
G
GAGCACATACACTTGGAGTTGCGAGATGCTCCTCCTTCAAGGCTAGACTTACCACCACAGATTCTTCACTGGACTCTTCTTTTGCAACCACTCTCTCTAAAACATGCAGTGCGGGTGAC
AATGCAGAGCAACCATTTGATGCCACGCGCAACGATTTCGACAATGCTTACTTCAATGCGCTTCAGAGGAAATCAGGAGTCCTCTTTTCAGACCAAACCTTATTCGACACTCCAAGGACC
AGGAATCTTGTTAATGGCTATGCCTTTAACCAAGCTAAGTTTTTCTTTGATTTCCAACAGGCCATGCGCAAAATGAGCAATCTTGATGTCAAACTTGCCTCTCAAGGTGAGGTCCGTCAA
AATTGTCGGAGACTTAACTAG

Retrieve as FASTA