Entry information : TsPrx49-2 (Thhalv10025683m / ThPrx49-2)
Entry ID 9823
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsPrx49-2 (Thhalv10025683m / ThPrx49-2)
Name (synonym) TsPrx49-2 (Thhalv10025683m / ThPrx49-2)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx49-2
start..stop
S start..stop
AalpPrx09 611 0 1..330 1..331
BrPrx49-2Aa_other 603 0 1..330 1..331
AhalPrx32 597 0 14..330 15..331
AruPrx49-2 597 0 14..330 15..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1537050..1537271 222 N° 2 1537358..1537549 192 N° 3 1537630..1537795 166 N° 4 1537912..1538324 413
join(1537050..1537271,1537358..1537549,1537630..1537795,1537912..1538324)


exon

Literature and cross-references TsPrx49-2 (Thhalv10025683m / ThPrx49-2)
DNA ref. Phytozome 12:   scaffold_1 (1537050..1538324)
Protein sequence: TsPrx49-2 (Thhalv10025683m / ThPrx49-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36150.17 (33711.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.06 (9.34) Peptide Signal:   %s   cut: 22 range:22-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARITSFLLLSLLCFLPLCLCHKGYGGKLFPGFYARSCPQAEEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDGSLLLDSSGGIVSEKSSNPNSKSARGFEVVDQIKAQLEKECPGIVSCADVLTLAARDSTVISGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSRFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQNGDGRPDMTLEQSFAANLRQRCPRSGGDQILSKLDMVSAARFDNSYFRNLVQNMGLLNSDQVLFSSNDQSRELVKKYAEDQGEFFRQFAQSMIKMGNISPLTGSSGEIRKNCRKINS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCACTAGCTTTCTCCTTCTTTCTCTCCTTTGTTTTCTCCCTCTCTGTCTCTGCCACAAGGGCTATGGAGGCAAACTCTTCCCAGGCTTTTACGCCCGGTCATGCCCGCAA
GCCGAGGAGATCGTGAGATCAGTTGTAGCCAAAGCTGTTGCTAGAGAGACCCGTATGGCTGCTTCCTTGCTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GTTTGCTTATTTTGTTCT
ACGTCCATCTATTTTTTTTTTGTTTATTACGTTAGTTACTTGGTGATAAAGCTCATTGTGAAACGCAGGGTTGTGATGGCTCTCTGCTTCTAGACAGCAGTGGGGGGATAGTGAGTGAGA
AAAGCTCGAACCCTAACAGCAAATCAGCTCGTGGATTCGAGGTAGTTGACCAGATTAAAGCTCAATTGGAGAAAGAGTGCCCTGGAATTGTCTCTTGCGCTGATGTTCTAACCCTAGCCG
CTAGAGACTCAACTGTTATT
GTAAGTCGATCTCATGCATAATCTCTGTTTTCTCGAACTCAAATTGAGAAACCAGCTGATTTAGTTTGGTTTTCGTTTAGTCTGGTGGACCAAGCTGGGT
GGTTCCTTTGGGAAGAAGAGATTCAAGAAGTGCAAGCTTGAGTGGTTCAAACAACAACATCCCTGCACCAAACAACACTTTTCAGACAATACTCTCAAGGTTTAACCGTCAAGGACTCGA
TGTCACCGACCTTGTCGCTCTCTCCG
GTAAGATTCATTTCACTCTATGACAGTTGCTTCACACGCACGGAATTCATCTATTAAAAGGAATCATATTACTTTACTTGCTTCTCAAGACACC
ATACTTCTTGACTGTTTCTCAGGAAGTCACACCATCGGATTCTCGAGATGCACGAGTTTCAGACAGAGGCTGTACAATCAGAACGGAGACGGCCGTCCAGACATGACACTGGAACAATCT
TTCGCTGCTAACTTGCGTCAAAGGTGTCCAAGATCCGGAGGAGACCAGATTCTCTCGAAGCTGGACATGGTCAGCGCGGCGAGATTCGACAACAGCTACTTCAGGAACTTGGTACAGAAC
ATGGGTTTGTTGAATTCGGACCAGGTTCTGTTCAGCAGTAACGATCAATCGAGAGAGCTTGTAAAGAAGTATGCAGAGGATCAAGGAGAATTCTTTAGGCAGTTTGCGCAGTCGATGATC
AAGATGGGAAATATCTCTCCTTTGACGGGTTCGAGTGGCGAAATCAGGAAGAACTGCAGGAAGATTAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCACTAGCTTTCTCCTTCTTTCTCTCCTTTGTTTTCTCCCTCTCTGTCTCTGCCACAAGGGCTATGGAGGCAAACTCTTCCCAGGCTTTTACGCCCGGTCATGCCCGCAA
GCCGAGGAGATCGTGAGATCAGTTGTAGCCAAAGCTGTTGCTAGAGAGACCCGTATGGCTGCTTCCTTGCTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GGTTGTGATGGCTCTCTG
CTTCTAGACAGCAGTGGGGGGATAGTGAGTGAGAAAAGCTCGAACCCTAACAGCAAATCAGCTCGTGGATTCGAGGTAGTTGACCAGATTAAAGCTCAATTGGAGAAAGAGTGCCCTGGA
ATTGTCTCTTGCGCTGATGTTCTAACCCTAGCCGCTAGAGACTCAACTGTTATT
TCTGGTGGACCAAGCTGGGTGGTTCCTTTGGGAAGAAGAGATTCAAGAAGTGCAAGCTTGAGTGGT
TCAAACAACAACATCCCTGCACCAAACAACACTTTTCAGACAATACTCTCAAGGTTTAACCGTCAAGGACTCGATGTCACCGACCTTGTCGCTCTCTCCG
GAAGTCACACCATCGGATTC
TCGAGATGCACGAGTTTCAGACAGAGGCTGTACAATCAGAACGGAGACGGCCGTCCAGACATGACACTGGAACAATCTTTCGCTGCTAACTTGCGTCAAAGGTGTCCAAGATCCGGAGGA
GACCAGATTCTCTCGAAGCTGGACATGGTCAGCGCGGCGAGATTCGACAACAGCTACTTCAGGAACTTGGTACAGAACATGGGTTTGTTGAATTCGGACCAGGTTCTGTTCAGCAGTAAC
GATCAATCGAGAGAGCTTGTAAAGAAGTATGCAGAGGATCAAGGAGAATTCTTTAGGCAGTTTGCGCAGTCGATGATCAAGATGGGAAATATCTCTCCTTTGACGGGTTCGAGTGGCGAA
ATCAGGAAGAACTGCAGGAAGATTAACTCTTGA

Retrieve as FASTA