Entry information : TsPrx[P]13 (Thhalv10019729m)
Entry ID 9831
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-29 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-04 (Christophe Dunand)
Peroxidase information: TsPrx[P]13 (Thhalv10019729m)
Name (synonym) TsPrx[P]13 (Thhalv10019729m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx[P]13
start..stop
S start..stop
AhalPrx56 229 9.43e-75 6..200 111..315
TsPrx13 228 2.15e-74 6..200 111..315
AlyPrx13 227 4.41e-74 6..200 111..315
AtPrx13 227 4.66e-74 6..200 111..315
Gene structure Fichier Exons


exon

Literature and cross-references TsPrx[P]13 (Thhalv10019729m)
DNA ref. Phytozome 12:   scaffold_9 (1531941..1530553)
Protein sequence: TsPrx[P]13 (Thhalv10019729m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238
PWM (Da):   %s   26304.43 Transmb domain:   %s   i209-231o
PI (pH):   %s   5.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
KAIVDVRGFKIIDDAKAKLEGVCLGNVSCSDIVALAACDAVFKKKGLFYQIPASRRDGLISTAENAANLQDAQDNIETLKSKFSDQGLSDRDLVLLSAVHTIAIWACFFVAPRLDTRNLD
ISSNFFCILRSRCP*GGDVGVKIPLDWDGDSILNNIKSGRTITASDSILYQDATTKKIIDNYLSNTTTFALDFDGAMWKMDMGRLNMNIFFSIFIIFCICFAYILHCLSIFFLFTYLI

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (There are gaps and stop in frame; 5' end is missing). No EST.
DNA
Send to BLAST
CDS
Send to BLAST