Entry information : TsPrx[P]62 (Thhalv10028309m)
Entry ID 9835
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-29 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-04 (Christophe Dunand)
Peroxidase information: TsPrx[P]62 (Thhalv10028309m)
Name (synonym) TsPrx[P]62 (Thhalv10028309m)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx[P]62
start..stop
S start..stop
AalpPrx62 366 9.94e-129 4..249 79..317
BstrPrx31 363 6.68e-128 4..249 79..317
BrPrx62-1Aa_other 363 1.12e-127 4..249 79..317
CagraPrx25 360 1.84e-126 4..249 79..317
Gene structure Fichier Exons


exon

Literature and cross-references TsPrx[P]62 (Thhalv10028309m)
DNA ref. Phytozome 12:   scaffold_14 (4225437..4228960)
Protein sequence: TsPrx[P]62 (Thhalv10028309m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247 (273)
PWM (Da):   %s   26517.32 (29756.2)  
PI (pH):   %s   9.54 (8.82) Peptide Signal:   %s   cut: 27 range:27-299
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGESGPNTERTAGANFNLHRFEVIDDARxQLEAASPFVSCADILTLAARDSVLLVSKGQSWQVPTGRRD*RVSFSMSVDNLPSPSDSVAVQQRKFAAFKLKIMDFVNLIGGHTIGTAVPV
CGFFTKRIFNTTGNTADPTMDQTFLPQLQRLCPQNGDxASRRMDLDAGMAILNFDTSFFNNLSRGRGILQSDQILWTNPTTR*LxSIVQEFMASRGNFNAQFAKSMVKMSNIGVKTGANG
EIRRVCSAI

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Long 5' end and PS in frame are missing which have been no found in genomic yet. Stop in frame.). No EST.
DNA
Send to BLAST
CDS
Send to BLAST