1. Browse the Database
  2. View Redoxidase
Entry information : PtritGPx01
Entry ID 9839
Creation 2011-11-23 (Passaia Gisèle)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PtritGPx01
Name PtritGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora tritici-repentis    [TaxId: 45151 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value PtritGPx01
start..stop		 S start..stop
PterGPx01 515 0 1..271 1..268
AalteGPx01 337 5.16e-118 13..271 1..239
SturGPx01 332 2.85e-117 104..271 1..168
ClunGPx01 328 9.2e-116 104..268 1..165
Gene structure Fichier Exons►


exon

Literature and cross-references PtritGPx01
DNA ref. JGI genome:   supercontig_1.12 (337938..338938)
Protein sequence: PtritGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271
PWM (Da):   %s   29860.52  
PI (pH):   %s   10.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMVLGRNSGVSHVVNGGGARGTAPQRVTRAGALVLKLRDSFTTTIPAIPVASAYHTTGYTASTLRLDHRDRLFGKTRIQIQQVFRYQKAFSRAFSFTTSKKPAMASATSFYEFKPKDKKG
AAYDLSKLNGKVVLVVNTASKCGFTPQFEGLEKLYKEVKAAHPNDFEILGFPCNQFGGQDPGSNDEIQEFCQLNYGVSFPVLGKIVNGATADPAFEWLKNEKPGLMGLKRVKWNFEKFLI
GRDGKVKGRWASTKKPEDLKAEIEKELNNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (supercontig_1.12:338061-339071, 2 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST