Entry information : PoVP01_PC15
Entry ID 9844
Creation 2011-11-25 (Christophe Dunand)
Last sequence changes 2012-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-06-09 (Catherine Mathe)
Peroxidase information: PoVP01_PC15
Name PoVP01_PC15
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP01_PC15
start..stop
S start..stop
PoVP01_IFO30160 731 0 1..361 1..361
PoVP01_PC9 729 0 1..358 1..358
PpulVP01 709 0 1..361 1..362
PoVP03_PC9 578 0 1..348 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 186553..186616 64 N° 2 186668..186801 134 N° 3 186852..186910 59 N° 4 186965..187102 138
N° 5 187160..187281 122 N° 6 187334..187409 76 N° 7 187460..187496 37 N° 8 187553..187560 8
N° 9 187612..187692 81 N° 10 187748..187817 70 N° 11 187887..187896 10 N° 12 187956..187991 36
N° 13 188053..188225 173 N° 14 188284..188323 40 N° 15 188382..188406 25 N° 16 188460..188472 13
join(186553..186616,186668..186801,186852..186910,186965..187102,187160..187281, 187334..187409,187460..187496,187553..187560,187612..187692,187748..187817,18788 7..187896,187956..187991,188053..188225,188284..188323,188382..188406,188460..18 8472)


exon

Literature and cross-references PoVP01_PC15
DNA ref. JGI genome:   scaffold_04 (186553..188472)
Cluster/Prediction ref. JGI gene:   1096331
Protein sequence: PoVP01_PC15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (339)
PWM (Da):   %s   38063.84 (35872.7)  
PI (pH):   %s   4.44 (4.44) Peptide Signal:   %s   cut: 23 range:23-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFASLSALVLAFAATVQVAQAVSLPQKRATCAGGQVTANAACCVLFPLMEDLQKNLFDDGACGEAHEALRLTFHDAIGFSPSRGVMGGADGSVITFSDTEVNFPANLGIDEIVEAEKPFLARHNISAGDLVHFAGTLAVTNCPGAPRIPFFLGRPPAKAASPIGLVPEPDTITDILARMDDAGFVSVEVVWLLSAHSVAAADHVDEIPGTPFDSTPNLFDSQIFIETQLRGISFPGTGGNHGEVQSPLKGEMRLQSDHFARDDRTSCEWQSMTNDQQKIQDRFSDTLFKMSMLGQNQDAMIDCSDVIPVPAALVTKPHLPAGKSKTDVEQCATGAFPALGADPGPVTSVPRVPPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCGCTTCGCTTTCTGCGCTCGTCCTTGCCTTCGCTGCGACTGTCCAAGTCGCTCAAGGTGAGCCACCGCGGCCCTTTCTACTGATTAGGCTAACACGACGTGCTTCAGCTGTG
TCTTTGCCTCAGAAACGCGCAACTTGTGCTGGCGGACAAGTTACCGCCAACGCGGCCTGTTGTGTCCTCTTCCCGCTCATGGAAGACCTACAGAAGAACTTGTTCGACGACGGCGCATGC
GGCGAAGAT
GTACGCTCGCTCAATTTACTACGACCCTTACTTATTGCTATCTATGCCAGGCGCATGAAGCCCTTCGCCTGACGTTCCACGACGCCATTGGATTCTCTCCTTCTAGGGGGT
AGGTCTTCGCCCATTTTGTATTGCGTGCCTGTTATTGATTTGTCGAGGACAGCGTTATGGGAGGCGCCGACGGCTCTGTCATCACATTCTCCGATACTGAGGTTAACTTCCCTGCCAACC
TTGGTATCGACGAGATCGTCGAAGCTGAGAAACCGTTCCTTGCAAGGCACAACATCTCCGCAGGCGATTT
GTACGCTATTCACTGGCATATTTGAGACTGAGAATCGACACTCACTACTT
TCCGCAGGGTTCACTTCGCCGGCACCCTCGCCGTTACCAACTGTCCTGGTGCTCCGCGAATCCCGTTCTTCTTAGGTCGCCCTCCAGCCAAGGCCGCATCACCCATTGGGTTAGTTCCGG
AACCATTCG
GTAAGCAGCTGTTTTCGTGACTTTGCCGCAGACTGCTAACGACTTTGAATAGATACCATCACAGATATCCTGGCCCGAATGGATGACGCTGGATTTGTCTCTGTCGAGGTT
GTCTGGCTCCTTTCCGC
GTACGCTAGACACCATTCGATCCCGAAATTATGGCTGACATAGCGTACAGGCACTCTGTCGCTGCAGCTGATCATGTTGACGAAACTGTAAGCATTACCCCAA
AAATTAACGATGTTCGAAGCTGACTTAACTTTTTGTAAAGATTCCTGGGTAAATTTTGCATACTAGCTTATTTTTCTCTTGTGGCTCACACGCACTCAGAACGCCGTTTGACTCAACGCC
AAACCTTTTCGATTCACAAATCTTCATCGAGACGCAACTCCGCGGAATTTCCTTCCCAGG
GTAATCAATTCTCCTAATGCCCAATCCACGTACATATTGCTTACTTGTTGAATAGCACTG
GTGGGAATCACGGCGAAGTACAATCCCCACTCAAGGGTGAGATGAGACTCCAGTCAGATCACTTG
GTTAGTCTTTACATTGCCCTCTTGCACTGAGAAGCGATCTCTAACATGACATGCG
TACCGATTTGACAGTTCGCTCGAGGTACTTGAAACTATTCATTCATAATAATATTTCCCCATTGAAACATCCAAATGTATCAGACGATAGGACATCCTGCGAATGGCAGTCCATGACTAG
TAAGTATCATGTTCTATCGCTTCCATTTCTCCTCCTAAGCTCACTATCAACGATAATTAGACGACCAACAGAAGATCCAAGACCGCTTCTCCGACACGCTGTTCAAGATGTCGATGCTTG
GACAAAACCAGGACGCCATGATCGATTGCTCCGATGTCATCCCCGTCCCCGCTGCCCTTGTAACCAAACCACATCTCCCCGCCGGGAAGAGCAAGACCGACGTTGAACAAGCC
GTACGTC
GCGCACTGTATCAGAGATCTCGCAACGTCGCTGAATTGTTTTCCTCTCCAGTGTGCCACTGGCGCCTTCCCTGCTCTCGGTGCTGACCCTGGTGAGTAAGCAGGCGATGTAGACACCAGA
AAACCTCTTACCCTTTGATTCTTCTTTAGGCCCAGTCACTTCTGTTCCTCGTGTGTAAGTGTCAACCTATGTCTCTATGAGTGCATTGATGCTAATGAACACCCTAGCCCACCTGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCGCTTCGCTTTCTGCGCTCGTCCTTGCCTTCGCTGCGACTGTCCAAGTCGCTCAAGCTGTGTCTTTGCCTCAGAAACGCGCAACTTGTGCTGGCGGACAAGTTACCGCCAAC
GCGGCCTGTTGTGTCCTCTTCCCGCTCATGGAAGACCTACAGAAGAACTTGTTCGACGACGGCGCATGCGGCGAAGAT
GCGCATGAAGCCCTTCGCCTGACGTTCCACGACGCCATTGGA
TTCTCTCCTTCTAGGGG
CGTTATGGGAGGCGCCGACGGCTCTGTCATCACATTCTCCGATACTGAGGTTAACTTCCCTGCCAACCTTGGTATCGACGAGATCGTCGAAGCTGAGAAACCG
TTCCTTGCAAGGCACAACATCTCCGCAGGCGATTT
GGTTCACTTCGCCGGCACCCTCGCCGTTACCAACTGTCCTGGTGCTCCGCGAATCCCGTTCTTCTTAGGTCGCCCTCCAGCCAAG
GCCGCATCACCCATTGGGTTAGTTCCGGAACCATTCG
ATACCATCACAGATATCCTGGCCCGAATGGATGACGCTGGATTTGTCTCTGTCGAGGTTGTCTGGCTCCTTTCCGCGCACTCT
GTCGCTGCAGCTGATCATGTTGACGAAACT
ATTCCTGGAACGCCGTTTGACTCAACGCCAAACCTTTTCGATTCACAAATCTTCATCGAGACGCAACTCCGCGGAATTTCCTTCCCAGGC
ACTGGTGGGAATCACGGCGAAGTACAATCCCCACTCAAGGGTGAGATGAGACTCCAGTCAGATCACTTG
TTCGCTCGAGACGATAGGACATCCTGCGAATGGCAGTCCATGACTAACGAC
CAACAGAAGATCCAAGACCGCTTCTCCGACACGCTGTTCAAGATGTCGATGCTTGGACAAAACCAGGACGCCATGATCGATTGCTCCGATGTCATCCCCGTCCCCGCTGCCCTTGTAACC
AAACCACATCTCCCCGCCGGGAAGAGCAAGACCGACGTTGAACAAGCC
TGTGCCACTGGCGCCTTCCCTGCTCTCGGTGCTGACCCTGGCCCAGTCACTTCTGTTCCTCGTGTCCCACCT
GCGTAA

Retrieve as FASTA