Entry information : MePrx141
Entry ID 9849
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: MePrx141
Name MePrx141
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx141
start..stop
S start..stop
MePrx89 602 0 1..335 1..334
MePrx80 598 0 1..335 1..334
RcPrx02 512 0 16..335 16..331
RcPrx04 476 1e-170 12..335 6..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 383302..383304 3 N° 2 383706..383928 223 N° 3 384043..384814 772  
join(383302..383304,383706..383928,384043..384814)


exon

Literature and cross-references MePrx141
DNA ref. Phytozome 12:   scaffold09492 (383302..384814)
Protein sequence: MePrx141
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   35652.73 Transmb domain:   %s   i7-29o
PI (pH):   %s   8.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSFRLNSLTILPSCIVFLVLCSLVTVSFPSLGVGFYKSSCPSAEAIVGKPVNKVVSQNxxLGAGLIRMLFYDCFIRGCEASVLLKSTPGNPLEREHVANNPSLRGFEVIDEAKAEIExLCPQTVSCADIIAFAARDSSYKLGGINYDVPAGRRDGRVSREDEVGQNLPPLFFNAQQLADNFGRKGMSVDEMVTLSGAHxSIGVSHCSSFCSRLYNFNATHAQDPFMDPRYAAFLKTKCPPPSANGVGGDPTVALDPTPNRMDNKYYMKSKKNGGLLTSDQTLMNGASTQRMVVNNARSPGTWANKFAKAMVHMGSLDVLTGTHGEIRRQCSVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome. join(383302..383304,383706..383928,384043..384814)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTACGTATTTGGCTTGGGGAGCAGCAGATTCACATTACATGCGTGGGTTGCTTAAGTTAGTTATACAGGCGGGAAATTAAGTTTGTTTTTTGCTTCTTTTTCATGTGTATTGCACAG
AAGCACCAACCGTGTTAGCGAGGGTTAAATTCGCGTATGAAGTTGGCTTTCCGTCGATAGAGAAAAAAAATAAATTCTGTAATTTTATGTCACGCTCTTTGTTATTTGCTATCTATGTTA
CTGCGTGGGATGTTCAGCTATAGCGACAACTATTTTAAATGTTTGTTCTCAATTTGTAGCTTTCAATTGTATTCCTTGTCAAATCAATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNCAACAAAGTTCATCATTATAAGCTATTCAATTCATACAAAGACTAGCTTCAGATTGAATTCTCTTACAATATTGCCATCTTGCATTGTTTTCCTTGTGCTTTGCTCATTAGTTACTG
TGTCTTTTCCATCCCTTGGAGTGGGATTCTATAAATCATCTTGCCCATCAGCAGAAGCAATTGTGGGAAAGCCGGTAAACAAAGTTGTGTCTCAAAATCNNNNNCTAGGTGCTGGCCTGA
TTAGGATGCTTTTCTATGATTGCTTTA
TTAGGGTATACATGCTCAAACCATATTTGCTTCTTTAATATTATAATCTTTATGTATGACATGGTTTTGTTTTGTTGCTTCACTATTTAAACA
CTGATGTTTCGTTCTATGTTTTACAGGGTTGTGAAGCTTCTGTGTTGTTGAAATCCACACCAGGAAACCCATTAGAGAGAGAACACGTAGCTAACAATCCTAGCTTACGAGGTTTTGAGG
TTATTGATGAAGCAAAGGCTGAAATTGAAACNTTATGTCCACAAACTGTATCATGCGCAGACATTATTGCTTTCGCTGCACGTGATAGTTCTTACAAACTTGGAGGGATAAACTACGATG
TGCCAGCAGGACGTCGAGATGGACGTGTGTCTAGAGAGGATGAAGTGGGACAAAACCTCCCTCCTTTATTCTTCAATGCACAACAACTCGCAGACAATTTTGGCCGTAAAGGAATGTCAG
TGGATGAGATGGTGACACTCTCTGGAGCACATATNTCCATTGGTGTCTCACACTGCTCTTCTTTCTGTAGCCGTCTCTACAACTTTAATGCCACTCATGCTCAAGATCCCTTTATGGATC
CTAGATATGCAGCTTTTTTGAAGACAAAGTGCCCTCCACCAAGTGCTAATGGGGTTGGTGGAGATCCCACAGTTGCACTTGATCCTACCCCTAATCGCATGGACAATAAATACTACATGA
AGTCGAAGAAGAATGGAGGATTATTAACTTCGGATCAGACATTGATGAACGGTGCTTCTACCCAGAGAATGGTGGTGAACAATGCAAGAAGTCCTGGAACATGGGCTAACAAGTTTGCTA
AGGCAATGGTGCACATGGGTTCTCTTGATGTTCTCACAGGAACTCACGGTGAAATTAGGAGGCAATGCAGCGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTAGCTTCAGATTGAATTCTCTTACAATATTGCCATCTTGCATTGTTTTCCTTGTGCTTTGCTCATTAGTTACTGTGTCTTTTCCATCCCTTGGAGTGGGATTCTATAAATCATCT
TGCCCATCAGCAGAAGCAATTGTGGGAAAGCCGGTAAACAAAGTTGTGTCTCAAAATCNNNNNCTAGGTGCTGGCCTGATTAGGATGCTTTTCTATGATTGCTTTA
TACAGGGTTGTGAA
GCTTCTGTGTTGTTGAAATCCACACCAGGAAACCCATTAGAGAGAGAACACGTAGCTAACAATCCTAGCTTACGAGGTTTTGAGGTTATTGATGAAGCAAAGGCTGAAATTGAAACNTTA
TGTCCACAAACTGTATCATGCGCAGACATTATTGCTTTCGCTGCACGTGATAGTTCTTACAAACTTGGAGGGATAAACTACGATGTGCCAGCAGGACGTCGAGATGGACGTGTGTCTAGA
GAGGATGAAGTGGGACAAAACCTCCCTCCTTTATTCTTCAATGCACAACAACTCGCAGACAATTTTGGCCGTAAAGGAATGTCAGTGGATGAGATGGTGACACTCTCTGGAGCACATATN
TCCATTGGTGTCTCACACTGCTCTTCTTTCTGTAGCCGTCTCTACAACTTTAATGCCACTCATGCTCAAGATCCCTTTATGGATCCTAGATATGCAGCTTTTTTGAAGACAAAGTGCCCT
CCACCAAGTGCTAATGGGGTTGGTGGAGATCCCACAGTTGCACTTGATCCTACCCCTAATCGCATGGACAATAAATACTACATGAAGTCGAAGAAGAATGGAGGATTATTAACTTCGGAT
CAGACATTGATGAACGGTGCTTCTACCCAGAGAATGGTGGTGAACAATGCAAGAAGTCCTGGAACATGGGCTAACAAGTTTGCTAAGGCAATGGTGCACATGGGTTCTCTTGATGTTCTC
ACAGGAACTCACGGTGAAATTAGGAGGCAATGCAGCGT

Retrieve as FASTA