Entry information : PtrGPx02
Entry ID 9851
Creation 2011-12-01 (Passaia Gisèle)
Last sequence changes 2011-12-01 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-20 (Christophe Dunand)
Peroxidase information: PtrGPx02
Name PtrGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3009]
Taxonomy Eukaryota Bacillariophyta Bacillariophyceae Phaeodactylaceae Phaeodactylum
Organism Phaeodactylum tricornutum    [TaxId: 2850 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtrGPx02
start..stop
S start..stop
TpsGPx02 190 3.62e-62 9..176 28..215
PiGPx03 127 1.46e-36 15..173 110..284
PparaGPx03 128 4.48e-36 15..175 233..409
PsojGPx03 124 1.29e-35 15..175 110..286
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9851' 'join(1..171,229..478,578..690)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..171 169 N° 2 229..478 248 N° 3 578..690 111  
join(1..171,229..478,578..690)


exon

Literature and cross-references PtrGPx02
Literature Bowler C et al (2008) The Phaeodactylum genome reveals the evolutionary history of diatom genomes. Nature 456:239–244
DNA ref. JGI genome:   chr_18 (446393..447409)
EST ref. GenBank:   CU717879.1 [3' end]
Protein sequence: PtrGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   177 (297)
PWM (Da):   %s   19729.7 (32236.1)  
PI (pH):   %s   5.86 (7.72) Peptide Signal:   %s   cut: 25 range:25-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNLFKRAFGKVHDASTRLIYGVEQTTQKMSFYSCADKSMDGEAV
PMSSFEGNVCLV
LVDEYGSRGLKILAFPCNQFGGQEPGSPEEILAFVAKYDKEMAKKLVFFEKADVNGANTREVYSYLKKTCPNEDGTTDIRWNFAKFLVDHEGNAVKRSTNSPFEMKDDIEALLKKKESSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 18, 2 introns) and ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAACCTCTTTAAACGAGCATTCGGTAAAGTACACGACGCCTCTACACGCTTGATCTACGGAGTCGAACAAACGACGCAAAAGATGAGTTTTTACAGCTGTGCGGACAAGAGCATG
GACGGCGAGGCTGTGCCCATGTCCAGCTTCGAAGGCAACGTTTGCCTGGTA
TAGTGAACGTGGCCTCGAAATGAGGCTTGACCAAAATGAACTATACCCAACTCCCGCAGCTTGTCGATG
AGTACGGAAGCCGCGGTTTAAAAATCCTCGCCTTTCCGTGTAATCAGTTTGGCGGTCAGGAACCGGGATCCCCTGAGGAAATCCTCGCGTTCGTTGCTAAATACGACAAGGAAATGGCAA
AGAAGCTCGTGTTCTTTGAGAAGGCCGACGTCAACGGAGCCAACACTCGGGAAGTCTACTCTTATTTGAAAAAGACCTGTCCGAATGAAGACGGAACAACCGATATTCGTTGGAACTTTG
TGGTAAGAGAAACAAGCGGAAAGCATTGGGGAAACTGGCAAACCAATGAATGTCTCTTGTTTTGCTAACTGTAAACCCTCGTTTTTCTTTTTCGAAAACAGCCAAATTCTTGGTGGATCA
CGAGGGGAATGCTGTCAAGCGTTCCACAAACTCGCCTTTTGAAATGAAGGACGACATTGAAGCTCTTTTGAAAAAGAAAGAAAGCTCGGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAACCTCTTTAAACGAGCATTCGGTAAAGTACACGACGCCTCTACACGCTTGATCTACGGAGTCGAACAAACGACGCAAAAGATGAGTTTTTACAGCTGTGCGGACAAGAGCATG
GACGGCGAGGCTGTGCCCATGTCCAGCTTCGAAGGCAACGTTTGCCTGGTA
CTTGTCGATGAGTACGGAAGCCGCGGTTTAAAAATCCTCGCCTTTCCGTGTAATCAGTTTGGCGGTCAG
GAACCGGGATCCCCTGAGGAAATCCTCGCGTTCGTTGCTAAATACGACAAGGAAATGGCAAAGAAGCTCGTGTTCTTTGAGAAGGCCGACGTCAACGGAGCCAACACTCGGGAAGTCTAC
TCTTATTTGAAAAAGACCTGTCCGAATGAAGACGGAACAACCGATATTCGTTGGAACTTTG
CCAAATTCTTGGTGGATCACGAGGGGAATGCTGTCAAGCGTTCCACAAACTCGCCTTTT
GAAATGAAGGACGACATTGAAGCTCTTTTGAAAAAGAAAGAAAGCTCGGCGTAG

Retrieve as FASTA