Entry information : GmPrx[P]325
Entry ID 9865
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx[P]325
Name GmPrx[P]325
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]325
start..stop
S start..stop
GmPrx189 258 1e-86 1..221 6..328
GmPrx195 251 7e-84 1..221 6..328
GmPrx312 213 7e-69 1..221 7..329
GmPrx190 202 6e-65 23..221 29..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 162760..162960 201 N° 2 163066..163182 117 N° 3 163203..163472 270 N° 4 163495..163569 75
join(162760..162960,163066..163182,163203..163472,163495..163569)


exon

Literature and cross-references GmPrx[P]325
DNA ref. Phytozome 12:   Gm20 (162760..163569)
Protein sequence: GmPrx[P]325
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219 (199)
PWM (Da):   %s   23265.53 (21249.5)  
PI (pH):   %s   6.83 (6.84) Peptide Signal:   %s   cut: 21 range:21-219
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLQMVSCLVLILGVSSLASAYLKVGFYSSACPSAEEIVRSTVNKAISDNAGIAAGLIRMHFHDCFVRGCDGSVLLASAPGNPIAERDNFVNNPSLHGFEVIEEAKTSNGDEVPQNLPAPTSSADEMVTLSGAHSIGVSHCSAFSHKIPLWTLHMPAH*KPSALHHLSPLPHPFVWTASTMRG*STTVAHASQTTREMVQMRSIEVLTGSDGEIRRHCSLVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stop in frame, PS is missing). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCAAATGGTTTCCTGCTTGGTTCTGATTCTAGGTGTTTCATCATTGGCTTCAGCATATCTGAAAGTGGGTTTCTACAGCTCCGCGTGTCCATCTGCCGAGGAAATAGTGAGAAGC
ACAGTAAACAAAGCAATTTCAGACAACGCGGGCATAGCTGCTGGACTCATTAGAATGCATTTCCATGATTGCTTTGTGAGG
GTAAGTTCAAGTCCATAATTTCGTATGCATATTAAAATA
TATCAGTTTCTGGTTACAATTAAATCAAGTCTCGGAAATTGATTGCTACTACGTACGTATGTAGAGGGTTGTGATGGTTCTGTGTTACTAGCATCTGCACCGGGTAATCCAATAGCCGAG
AGAGACAATTTCGTGAACAACCCAAGCTTGCATGGCTTCGAGGTGATCGAGGAGGCCAAGACC
CAATTAGAGGCTGCATGCCCTCAAACGGTGATGAAGTGCCCCAGAATCTGCCTGCAC
CAACCTCCAGTGCAGATGAAATGGTCACACTTTCAGGAGCGCATTCAATAGGTGTGTCGCATTGTTCTGCCTTCTCACACAAGATCCCTCTATGGACTCTTCATATGCCGGCGCACTGAA
AACCAAGTGCCCTGCACCACCTTTCACCACTTCCACACCCATTCGTTTGGACAGCAAGTACTATGAGGGGTTGATCAACCACCGTGGCGCACGCCAGTCAAACCACAAGGGAA
ATGGTTC
AAAGCAATGCTAACAATGGTGCAAATGCGTTCCATAGAAGTCCTTACGGGCTCTGATGGCGAGATAAGGAGACACTGCAGCCTTGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCAAATGGTTTCCTGCTTGGTTCTGATTCTAGGTGTTTCATCATTGGCTTCAGCATATCTGAAAGTGGGTTTCTACAGCTCCGCGTGTCCATCTGCCGAGGAAATAGTGAGAAGC
ACAGTAAACAAAGCAATTTCAGACAACGCGGGCATAGCTGCTGGACTCATTAGAATGCATTTCCATGATTGCTTTGTGAGG
GGTTGTGATGGTTCTGTGTTACTAGCATCTGCACCGGGT
AATCCAATAGCCGAGAGAGACAATTTCGTGAACAACCCAAGCTTGCATGGCTTCGAGGTGATCGAGGAGGCCAAGACC
TCAAACGGTGATGAAGTGCCCCAGAATCTGCCTGCACCAACC
TCCAGTGCAGATGAAATGGTCACACTTTCAGGAGCGCATTCAATAGGTGTGTCGCATTGTTCTGCCTTCTCACACAAGATCCCTCTATGGACTCTTCATATGCCGGCGCACTGAAAACCA
AGTGCCCTGCACCACCTTTCACCACTTCCACACCCATTCGTTTGGACAGCAAGTACTATGAGGGGTTGATCAACCACCGTGGCGCACGCCAGTCAAACCACAAGGGAA
ATGGTGCAAATG
CGTTCCATAGAAGTCCTTACGGGCTCTGATGGCGAGATAAGGAGACACTGCAGCCTTGTTAAT

Retrieve as FASTA