Entry information : GmPrx[P]326
Entry ID 9866
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx[P]326
Name GmPrx[P]326
Class Class III peroxidase     [Orthogroup: Prx037]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]326
start..stop
S start..stop
MtPrx34 266 1e-90 1..177 87..318
MePrx35 263 1e-89 1..177 85..316
MtPrx37 258 1e-87 1..177 87..320
GmPrx22 258 2e-87 1..177 83..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1606772..1606919 148 N° 2 1607251..1607636 386  
join(1606772..1606919,1607251..1607636)


exon

Literature and cross-references GmPrx[P]326
DNA ref. Phytozome 12:   Gm18 (1606772..1607636)
Protein sequence: GmPrx[P]326
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   177
PWM (Da):   %s   19372.87  
PI (pH):   %s   8.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GEKTAAPNNNSVRGFNVIDDIKTKVEKACPQVVSCADILALAARDSVVYGGHTIGLARCVTFRDHIYNDSDIDASFAKSLQSKCPRSGNDDLLEPLDLQTPTHFDNLYFQNLLDKKGLLHSDQKLFNGDSTNKLVKKYATNTAAFFKDFAKGMVKMSNIKPLTGSEGQIRINCRKVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end and PS in frame are missing). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAGAGAAAACTGCAGCACCTAACAATAATTCAGTTAGAGGGTTCAACGTGATCGATGACATTAAAACCAAGGTGGAGAAAGCATGTCCCCAGGTTGTGTCATGTGCTGATATTCTTGCT
CTGGCCGCTCGAGACTCTGTTGTTTATG
AACGTAATAAGCAATCTCAAATCTCAATAGTATTCATGTTTATGACCCTTAAAAGGCATGTATCTAAAAAGGGACAGCATTTGTTTTGATGA
TCCGTATAAGGTACGACTAAATAAAGGCTTTCTCAAGAATATATATTTCTAGTCTGTTTTAGATTGAAATAGGATAAGAGAAGTTATGAGTGTTAAAGAGGCTTCCTCTACTACACTCTA
CCCACTATTTATTGCCAAAATTGACCACTCTTCATCTTCCAAAAATTTTGCTTAGAAGAAGAGTTTGGCATGTTATGCCCAAGATATACTTCAATTCACTCGAGTATGTTTGATGACAGG
TGGACATACTATTGGCCTTGCTAGATGCGTAACATTCAGAGATCACATCTACAATGATTCCGACATTGATGCCTCCTTTGCCAAGTCCCTGCAGAGCAAGTGCCCCAGAAGTGGAAATGA
CGATTTACTCGAACCCCTTGACCTTCAAACTCCTACCCATTTTGATAACCTATACTTCCAGAATTTACTGGACAAAAAGGGTCTTCTCCATTCCGATCAGAAGCTGTTCAATGGTGATTC
CACCAACAAACTGGTGAAGAAATATGCTACCAATACAGCTGCATTCTTTAAAGACTTTGCCAAGGGCATGGTCAAAATGAGCAATATCAAGCCTCTAACAGGAAGCGAGGGGCAGATCAG
AATCAATTGCAGAAAAGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAGAGAAAACTGCAGCACCTAACAATAATTCAGTTAGAGGGTTCAACGTGATCGATGACATTAAAACCAAGGTGGAGAAAGCATGTCCCCAGGTTGTGTCATGTGCTGATATTCTTGCT
CTGGCCGCTCGAGACTCTGTTGTTTATG
GTGGACATACTATTGGCCTTGCTAGATGCGTAACATTCAGAGATCACATCTACAATGATTCCGACATTGATGCCTCCTTTGCCAAGTCCCTG
CAGAGCAAGTGCCCCAGAAGTGGAAATGACGATTTACTCGAACCCCTTGACCTTCAAACTCCTACCCATTTTGATAACCTATACTTCCAGAATTTACTGGACAAAAAGGGTCTTCTCCAT
TCCGATCAGAAGCTGTTCAATGGTGATTCCACCAACAAACTGGTGAAGAAATATGCTACCAATACAGCTGCATTCTTTAAAGACTTTGCCAAGGGCATGGTCAAAATGAGCAATATCAAG
CCTCTAACAGGAAGCGAGGGGCAGATCAGAATCAATTGCAGAAAAGTCAATTAA

Retrieve as FASTA